y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g35720.2
FamilyGH16
Protein PropertiesLength: 211 Molecular Weight: 24830.8 Isoelectric Point: 8.4634
ChromosomeChromosome/Scaffold: 18 Start: 41960927 End: 41963643
Descriptionxyloglucan endotransglucosylase/hydrolase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1611341.3e-22
  MRIKIPNKDCRGVVTAFYLTSTAYKHLGAKHDEIDFEFLGNNGQPHTLQTNVFTNDEGGREQRHSLWFDPTIIFHTYGVLWNQHQIVFYVDEIPIRVFKN
  YSNVGVSFPSQQMHVTASIWNGEPWASNGKRIDW
Full Sequence
Protein Sequence     Length: 211     Download
MRIKIPNKDC RGVVTAFYLT STAYKHLGAK HDEIDFEFLG NNGQPHTLQT NVFTNDEGGR    60
EQRHSLWFDP TIIFHTYGVL WNQHQIVFYV DEIPIRVFKN YSNVGVSFPS QQMHVTASIW    120
NGEPWASNGK RIDWKQAPFT AQFQGFNIHG CQTQNYNKHA CYSPYLWWND KKHWKLNSQQ    180
QRAYEDVRKK HLLYDYCSDR GELHKECQIN *                                   240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02175GH16_lichenase3.0e-1812124113+
cd02183GH16_fungal_CRH1_transglycosylase6.0e-2211157162+
pfam00722Glyco_hydro_164.0e-501135138+
PLN03161PLN031613.0e-591207218+
cd02176GH16_XET5.0e-981207215+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19906.1012101210unknown [Glycine max]
EMBLCAN73201.10120782288hypothetical protein [Vitis vinifera]
EMBLCBI33049.10120782284unnamed protein product [Vitis vinifera]
RefSeqXP_002271604.10120716222PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002301792.10120062260predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B0120864273A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB1un1_A0120864273A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB1umz_B0120864273A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A0120864273A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2uwb_B2e-39320767267A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO980946193192110
EV27108014411440
CO11654920812000
ES82789222112100
GR20918920312000
Orthologous Group
SpeciesID
Arabidopsis lyrata884593899104485216359038359039
883627883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g44777.1Bradi1g71937.1
Brassica rapaBra001434Bra015093Bra001433
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.1Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129900.1Phvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny