y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g39540.1
FamilyGT59
Protein PropertiesLength: 506 Molecular Weight: 57523.1 Isoelectric Point: 9.2948
ChromosomeChromosome/Scaffold: 18 Start: 47587275 End: 47594954
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59244570
  IVPEPYMDEIFHIPQAQQYCKGNFGSWDPMITTPPGLYYLSLAHVASLFPGFYCVEAASISDLCSAAILRSINGVLAVVCSLILYDIVTHLKPTLNDRKA
  MLHAVVLSLYPLHWFFTFLYYTDVASVTAVLAMYLASLKKNYWFSALIGAFAVVIRQTNIIWVLFVACTGIINISVAHAKHSTKTDEPDVSIKHGLAYAT
  GTNTEGFNLRKRKIVKSIGNSSSSLLASSPSFSSGFADEIWSILLTLWYMKWELLISFSPYLMMVVAFLLFVYWNGSVVLGAKEAHAVTPHFAQMLYFSL
  VSVLAQAPMHFTITKAVDLFQMFRKSRALLFFQMFLALVVGLLSVHFFSVAHPYLLADNRHYPFYLWKKVIMAHWSIKYLLVPVYICSWLSIIHMLGKFR
  SKIWALAYFLATAAVLVPAPLIEFRYYTIPFYFL
Full Sequence
Protein Sequence     Length: 506     Download
MGKIALAVIV SLWVIPTTVM VNRIVPEPYM DEIFHIPQAQ QYCKGNFGSW DPMITTPPGL    60
YYLSLAHVAS LFPGFYCVEA ASISDLCSAA ILRSINGVLA VVCSLILYDI VTHLKPTLND    120
RKAMLHAVVL SLYPLHWFFT FLYYTDVASV TAVLAMYLAS LKKNYWFSAL IGAFAVVIRQ    180
TNIIWVLFVA CTGIINISVA HAKHSTKTDE PDVSIKHGLA YATGTNTEGF NLRKRKIVKS    240
IGNSSSSLLA SSPSFSSGFA DEIWSILLTL WYMKWELLIS FSPYLMMVVA FLLFVYWNGS    300
VVLGAKEAHA VTPHFAQMLY FSLVSVLAQA PMHFTITKAV DLFQMFRKSR ALLFFQMFLA    360
LVVGLLSVHF FSVAHPYLLA DNRHYPFYLW KKVIMAHWSI KYLLVPVYIC SWLSIIHMLG    420
KFRSKIWALA YFLATAAVLV PAPLIEFRYY TIPFYFLVLH CNNRDDQSWI LTGTLYIGVN    480
IFTMMMFLFR PFHWDHEPGI QRFIW*                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG107.0e-8922456436+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1015051498putative protein [Arabidopsis thaliana]
EMBLCAN64153.102750527517hypothetical protein [Vitis vinifera]
RefSeqNP_195861.2015051509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.102750527510PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509451.102737127376conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
426
4769
89111
123145
165187
277299
314336
357379
394416
428450
470492
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2821882421413800
BU5497161983095060
HO8071392053025060
FS33453820912080
DN49573823812360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny