y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g39540.4
FamilyGT59
Protein PropertiesLength: 337 Molecular Weight: 38553.6 Isoelectric Point: 10.0266
ChromosomeChromosome/Scaffold: 18 Start: 47587275 End: 47594954
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT5922880
  LHAVVLSLYPLHWFFTFLYYTDVASVTAVLAMYLASLKKNYWFSALIGAFAVVIRQTNIIWVLFVACTGIINISVAHAKHSTKTDEPDVSIKHGLAYATG
  TNTEGFNLRKRKIVKSIGNSSSSLLASSPSFSSGAKEAHAVTPHFAQMLYFSLVSVLAQAPMHFTITKAVDLFQMFRKSRALLFFQMFLALVVGLLSVHF
  FSVAHPYLLADNRHYPFYLWKKVIMAHWSIKYLLVPVYICSWLSIIHMLGKFRSKIWALAYFLATAAVLVPAPLIEFRYYTIPFYFL
Full Sequence
Protein Sequence     Length: 337     Download
MLHAVVLSLY PLHWFFTFLY YTDVASVTAV LAMYLASLKK NYWFSALIGA FAVVIRQTNI    60
IWVLFVACTG IINISVAHAK HSTKTDEPDV SIKHGLAYAT GTNTEGFNLR KRKIVKSIGN    120
SSSSLLASSP SFSSGAKEAH AVTPHFAQML YFSLVSVLAQ APMHFTITKA VDLFQMFRKS    180
RALLFFQMFL ALVVGLLSVH FFSVAHPYLL ADNRHYPFYL WKKVIMAHWS IKYLLVPVYI    240
CSWLSIIHML GKFRSKIWAL AYFLATAAVL VPAPLIEFRY YTIPFYFLVL HCNNRDDQSW    300
ILTGTLYIGV NIFTMMMFLF RPFHWDHEPG IQRFIW*                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG101.0e-492287299+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.104336129498putative protein [Arabidopsis thaliana]
GenBankEEE61284.104336128481hypothetical protein OsJ_15367 [Oryza sativa Japonica Group]
RefSeqNP_195861.204336129509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_001780691.104336128508predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002270322.102336126510PREDICTED: hypothetical protein [Vitis vinifera]
Transmembrane Domains
StartEnd
1234
5476
183205
225247
259281
301323
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU5497161981403370
HO8071392031353370
FG8203561901483370
AL3890491591793370
AL3813801561823370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny