y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g40011.1
FamilyGH85
Protein PropertiesLength: 287 Molecular Weight: 32311.1 Isoelectric Point: 7.9569
ChromosomeChromosome/Scaffold: 18 Start: 48467625 End: 48470334
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH851552852.7e-32
  KVLGTFITKWDEGKVVCDTLFSTKETAHMYAECLVELAVDLGFDGWLKRSLSLIMHSSMLGSLVIWYDSVTLDGKLNWQDQVNEHNKPFFDICDGIFVNY
  TWKEDYPRLSTAVAGNWKFDVYMGIDVFENK
Full Sequence
Protein Sequence     Length: 287     Download
MSALLSLPSN STSFWRSPRR FAATTMYNIA ISSTNIVQSR TTIATRTTLA RCSDFPLPLH    60
SLPEKHNSGF PASTLSGSFT KNSMSGTRPV NLLYEMFSTT RFCRPARYWS RPIHVITNFF    120
CISCLLGAAT FGEDVAISSF AFHCCHASVK LSYMKVLGTF ITKWDEGKVV CDTLFSTKET    180
AHMYAECLVE LAVDLGFDGW LKRSLSLIMH SSMLGSLVIW YDSVTLDGKL NWQDQVNEHN    240
KPFFDICDGI FVNYTWKEDY PRLSTAVAGN WKFDVYMGID VFENKF*                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4724COG47242.0e-11156281154+
cd06547GH85_ENGase3.0e-40155282151+
pfam03644Glyco_hydro_853.0e-40155282149+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI25424.1015428228174unnamed protein product [Vitis vinifera]
RefSeqNP_187715.10154282130276glycosyl hydrolase family 85 protein [Arabidopsis thaliana]
RefSeqXP_002273683.10154282126272PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.10154282130276predicted protein [Populus trichocarpa]
RefSeqXP_002315138.10154285131280predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fha_D0.0000008185281153271A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_C0.0000008185281153271A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_B0.0000008185281153271A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_A0.0000008185281153271A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB2vtf_B0.0000008185281158276A Chain A, X-Ray Crystal Structure Of The Endo-Beta-N- Acetylglucosaminidase From Arthrobacter Protophormiae E173q Mutant Reveals A Tim Barrel Catalytic Domain And Two Ancillary Domains
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FS3473911451562820
CX1281011471542820
EY8628271471542820
EL3449861471542820
BM1884701431542780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1Glyma14g06120.1
Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny