y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g40150.1
FamilyCE13
Protein PropertiesLength: 227 Molecular Weight: 25255.8 Isoelectric Point: 6.8487
ChromosomeChromosome/Scaffold: 18 Start: 48672076 End: 48674751
DescriptionPectinacetylesterase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE13281400
  SVMVGLTVIQSAAGKGAVCLDGTLLAYHLHRGYGSGANSWIVNLEGGGWCNDVRSCVYRKKTQRGSSTFMEKQIPFTGILSNNVEDNPDFFNWNRVKIRY
  CDGASFAGDAEDK
Full Sequence
Protein Sequence     Length: 227     Download
MGNLLWLCIV ATLVFSFWVH SSLLGRTSVM VGLTVIQSAA GKGAVCLDGT LLAYHLHRGY    60
GSGANSWIVN LEGGGWCNDV RSCVYRKKTQ RGSSTFMEKQ IPFTGILSNN VEDNPDFFNW    120
NRVKIRYCDG ASFAGDAEDK VDFDVLELLK IETALNFTLE LSLHFTPLCI PTQHHALSRQ    180
NGLFINSCFG HCQSERQDTW FADNSPAIGK KVVKNIASWY VEEFVY*                  240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE2.0e-1217822650+
pfam03283PAE3.0e-6520138119+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI39680.10301411112unnamed protein product [Vitis vinifera]
EMBLCBI39680.10.00000000001176223295343unnamed protein product [Vitis vinifera]
RefSeqXP_002279030.101014140170PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002279030.10.00000000001176223353401PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002279043.101014040169PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
Transmembrane Domains
StartEnd
224
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DB96242116011350
BW661522123191410
FF38913016311380
FY45621215911410
FG93237616511410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00270.1Aquca_047_00106.1Aquca_009_00049.1Aquca_013_00328.2Aquca_013_00328.3
Aquca_003_00241.1Aquca_029_00002.1Aquca_013_00328.1Aquca_006_00270.2Aquca_029_00002.3
Aquca_009_00049.7Aquca_009_00049.5Aquca_009_00049.9Aquca_009_00049.10Aquca_009_00049.4
Aquca_029_00104.1Aquca_007_00862.1Aquca_009_00049.6Aquca_003_00241.2.52.273Aquca_003_00241.2.52.273
Aquca_009_00049.3Aquca_009_00049.2Aquca_009_00049.11Aquca_009_00049.8Aquca_029_00002.2.64.266
Aquca_029_00002.2.64.266Aquca_003_00035.1Aquca_003_00035.2Aquca_003_00035.4Aquca_003_00035.3
Aquca_003_00036.1Aquca_029_00002.2.264.363Aquca_029_00002.2.264.363Aquca_003_00241.2.270.374Aquca_003_00241.2.270.374
Arabidopsis lyrata492919492921478260494455478262
483863477888489494474842486713
311997907665866320897101.332.432897101.332.432
897101.332.432897101.70.204897101.70.204897101.70.204
Arabidopsis thalianaAT3G62060.1AT4G19420.2AT4G19420.1AT4G19410.2AT4G19410.1
AT3G09405.1AT5G26670.2AT3G09410.1AT5G45280.2AT2G46930.1
AT3G05910.1AT3G09410.3AT1G57590.1AT5G26670.1AT5G23870.3
AT5G23870.2AT5G23870.1AT1G09550.1AT5G45280.1AT3G05910.2
Brachypodium distachyonBradi2g38780.1Bradi1g50397.1Bradi2g62420.1Bradi2g62427.3Bradi2g62427.4
Bradi2g62427.2Bradi1g20270.1Bradi2g62410.1Bradi5g20827.1Bradi3g52600.1
Bradi2g12047.2Bradi2g12057.1Bradi3g52600.3Bradi2g12047.1Bradi3g32865.1.69.220
Bradi3g32865.1.69.220Bradi2g62427.1.167.266Bradi2g62427.1.167.266Bradi3g32865.1.224.369Bradi3g32865.1.224.369
Brassica rapaBra004494Bra013395Bra014412Bra020962Bra021961
Bra013394Bra018805Bra029767Bra034069Bra001307
Bra036587Bra020963Bra020800Bra001172Bra009909
Bra009711Bra007657Bra027913Bra030784Bra029386
Bra002014.52.273Bra002014.52.273Bra020015Bra002014.274.374Bra002014.274.374
Carica papayaevm.model.supercontig_920.1evm.model.supercontig_107.67evm.model.supercontig_143.4evm.model.supercontig_143.7evm.model.supercontig_48.227
evm.model.supercontig_57.34evm.model.supercontig_228.11
Capsella rubellaCarubv10005004mCarubv10005284mCarubv10026563mCarubv10013780mCarubv10001019m
Carubv10013814mCarubv10023292mCarubv10017332mCarubv10001048mCarubv10020343m
Carubv10011324mCarubv10020590m
Citrus clementinaCiclev10005117mCiclev10005115mCiclev10012308mCiclev10028674mCiclev10011805m
Ciclev10011803mCiclev10011802mCiclev10020385mCiclev10001467mCiclev10001426m
Ciclev10001371mCiclev10028934mCiclev10030247mCiclev10021084m
Citrus sinensisorange1.1g015995morange1.1g015955morange1.1g022081morange1.1g022038morange1.1g014476m
orange1.1g014431morange1.1g015266morange1.1g016608morange1.1g016602morange1.1g017379m
orange1.1g015845morange1.1g013734morange1.1g014548morange1.1g020895morange1.1g020893m
orange1.1g020755morange1.1g020598morange1.1g020584morange1.1g022338morange1.1g020823m
orange1.1g021817morange1.1g020169morange1.1g017366m.26.245orange1.1g017366m.26.245orange1.1g024695m
orange1.1g024663morange1.1g026241morange1.1g025935morange1.1g035542morange1.1g025752m
orange1.1g017366m.248.348orange1.1g017366m.248.348
Cucumis sativusCucsa.051040.3Cucsa.051040.2Cucsa.228720.4Cucsa.228720.3Cucsa.228720.2
Cucsa.228720.1Cucsa.051040.1Cucsa.107870.1Cucsa.107870.8Cucsa.107870.9
Cucsa.107870.7Cucsa.066180.1Cucsa.066190.1
Eucalyptus grandisEucgr.E01170.5Eucgr.E01170.2Eucgr.E01170.1Eucgr.E01170.4Eucgr.E01170.3
Eucgr.E01169.5Eucgr.E01169.4Eucgr.E01169.3Eucgr.E01169.2Eucgr.E01169.1
Eucgr.D02577.1Eucgr.E01170.6Eucgr.B01828.1Eucgr.A00994.1Eucgr.H01338.1
Eucgr.A02777.2Eucgr.A02777.1Eucgr.A01665.2Eucgr.A01665.1Eucgr.B01829.1
Eucgr.B02195.1Eucgr.B01829.2Eucgr.H01338.2.153.367Eucgr.H01338.2.153.367Eucgr.H01338.2.57.153
Eucgr.H01338.2.57.153
Fragaria vescamrna27697.1-v1.0-hybridmrna13256.1-v1.0-hybridmrna12396.1-v1.0-hybridmrna27699.1-v1.0-hybridmrna22960.1-v1.0-hybrid.424.772
mrna22960.1-v1.0-hybrid.424.772mrna22960.1-v1.0-hybrid.424.772mrna22960.1-v1.0-hybrid.47.391mrna22960.1-v1.0-hybrid.47.391mrna22960.1-v1.0-hybrid.47.391
mrna18404.1-v1.0-hybridmrna22775.1-v1.0-hybrid.42.210mrna22775.1-v1.0-hybrid.42.210mrna22775.1-v1.0-hybrid.210.356mrna22775.1-v1.0-hybrid.210.356
mrna05084.1-v1.0-hybrid
Glycine maxGlyma01g35480.6Glyma01g35480.5Glyma01g35480.4Glyma01g35480.2Glyma16g17190.6
Glyma16g17190.5Glyma16g17190.1Glyma16g08240.1Glyma09g35050.6Glyma09g35050.5
Glyma09g35050.1Glyma16g17120.1Glyma16g17150.1Glyma09g35050.3Glyma10g37890.2
Glyma16g08230.1Glyma16g08230.3Glyma16g08230.2Glyma13g17740.6Glyma13g17740.5
Glyma18g39570.1Glyma19g41240.1Glyma03g38650.1Glyma18g39570.2Glyma10g28230.1
Glyma19g41030.2Glyma19g41030.1Glyma03g38430.2Glyma03g38430.1Glyma20g22210.1
Glyma13g17740.4Glyma13g17740.3Glyma13g17740.2Glyma17g04770.1Glyma02g00930.1
Glyma10g28230.2Glyma10g27960.1Glyma10g27960.2Glyma20g29930.4Glyma20g29930.3
Glyma16g17120.2Glyma10g27960.3Glyma13g03730.1
Gossypium raimondiiGorai.004G175900.1Gorai.004G176200.6Gorai.004G176200.5Gorai.004G176200.4Gorai.004G176200.3
Gorai.004G176200.2Gorai.004G176200.1Gorai.008G276500.2Gorai.008G276500.1Gorai.004G176200.7
Gorai.008G276500.4Gorai.008G276500.3Gorai.013G131600.1Gorai.013G211000.1Gorai.007G118400.2
Gorai.007G118400.1Gorai.013G211000.4Gorai.008G133500.1Gorai.013G131600.3Gorai.013G131600.2
Gorai.002G257800.2Gorai.002G257800.1Gorai.012G103700.3Gorai.012G103700.2Gorai.012G103700.1
Gorai.013G131600.4Gorai.013G211000.3Gorai.008G133500.3Gorai.008G133500.4Gorai.008G133500.2
Gorai.013G211000.2Gorai.012G103700.4Gorai.004G175900.2
Linum usitatissimumLus10034767Lus10033305Lus10033301Lus10037269Lus10035682
Lus10034762Lus10039238Lus10007200Lus10024398Lus10038024
Lus10009966Lus10034766Lus10033304Lus10010084.203.368Lus10010084.203.368
Lus10010084.64.204Lus10010084.64.204Lus10025347.63.150Lus10025347.63.150Lus10000253
Malus domesticaMDP0000756536MDP0000286498MDP0000171708MDP0000834641MDP0000163930
MDP0000202156MDP0000193151MDP0000162976MDP0000200867MDP0000310803
MDP0000243428MDP0000273242MDP0000207848MDP0000171707MDP0000221319.149.411
MDP0000221319.149.411MDP0000188229.149.411MDP0000188229.149.411MDP0000279892MDP0000253085.607.818
MDP0000253085.607.818MDP0000869939MDP0000313863.24.193MDP0000313863.24.193MDP0000248589
MDP0000186817.220.475MDP0000186817.220.475MDP0000275189MDP0000253085.818.916MDP0000253085.818.916
MDP0000186818MDP0000218292MDP0000313863.193.341MDP0000313863.193.341MDP0000258999
MDP0000212077MDP0000186817.99.187MDP0000186817.99.187MDP0000221319.24.113MDP0000221319.24.113
MDP0000188229.24.113MDP0000188229.24.113
Manihot esculentacassava4.1_032614mcassava4.1_008588mcassava4.1_032451mcassava4.1_007245mcassava4.1_024915m
cassava4.1_027434mcassava4.1_009130mcassava4.1_009152mcassava4.1_009149mcassava4.1_008923m
cassava4.1_008511mcassava4.1_029863mcassava4.1_008507mcassava4.1_007275mcassava4.1_011665m
cassava4.1_009564mcassava4.1_028266m
Medicago truncatulaMedtr8g072010.1Medtr8g072000.1Medtr5g042650.1Medtr1g101000.1Medtr1g101020.1
Medtr7g110900.2Medtr7g110900.1Medtr7g060760.1Medtr4g124320.1Medtr7g111280.1
Medtr1g085070.1
Mimulus guttatusmgv1a023759mmgv1a007810mmgv1a007934mmgv1a007782mmgv1a007656m
mgv1a007102mmgv1a007602mmgv1a010619mmgv1a007479mmgv1a007660m
mgv1a008697mmgv1a006907mmgv1a006506mmgv1a007583mmgv1a011392m
mgv1a010255mmgv1a012163mmgv1a021236mmgv1a019134mmgv1a019753m.167.311
mgv1a019753m.167.311mgv1a011422m.129.254mgv1a011422m.129.254mgv1a015116mmgv1a016175m
mgv1a019740m
Oryza sativaLOC_Os05g02120.1LOC_Os02g47400.1LOC_Os01g74330.1LOC_Os02g47400.2LOC_Os01g66840.1
LOC_Os01g66830.1LOC_Os01g66850.1LOC_Os07g44070.2LOC_Os01g21630.1LOC_Os04g51340.1
LOC_Os07g44070.1LOC_Os10g40290.1.74.208LOC_Os10g40290.1.74.208LOC_Os10g40290.1.224.375LOC_Os10g40290.1.224.375
Panicum virgatumPavirv00064077mPavirv00033561mPavirv00064079mPavirv00044124mPavirv00070012m
Pavirv00064080mPavirv00010768mPavirv00036492mPavirv00016312mPavirv00042781m
Pavirv00053749mPavirv00002139mPavirv00015127mPavirv00008793mPavirv00070395m
Pavirv00014133mPavirv00034669mPavirv00069487mPavirv00030753mPavirv00033562m
Pavirv00029888mPavirv00064078mPavirv00064081m.47.270Pavirv00064081m.47.270Pavirv00026712m.209.417
Pavirv00026712m.209.417Pavirv00032744m.210.418Pavirv00032744m.210.418Pavirv00032744m.36.183Pavirv00032744m.36.183
Pavirv00060334m.57.202Pavirv00060334m.57.202Pavirv00026712m.35.182Pavirv00026712m.35.182Pavirv00064081m.267.369
Pavirv00064081m.267.369Pavirv00015223mPavirv00047470m
Physcomitrella patensPp1s136_39V6.2Pp1s136_39V6.1
Phaseolus vulgarisPhvul.003G277600.1Phvul.002G123900.1Phvul.003G277500.2Phvul.003G277500.1Phvul.001G219200.2
Phvul.001G219200.1Phvul.007G206300.1Phvul.001G221400.2Phvul.001G221400.1Phvul.008G101100.1
Phvul.003G124700.2Phvul.007G208200.1Phvul.007G071700.1Phvul.003G124700.1Phvul.008G101100.2
Phvul.010G075200.1
Picea abiesMA_10432685g0010MA_340147g0010MA_3303g0010MA_52077g0010MA_10436630g0010
MA_9497g0010MA_10333321g0010MA_10433002g0010MA_8032g0010MA_10333199g0010.92.192
MA_10333199g0010.92.192MA_10435510g0010MA_10435736g0010MA_6644500g0010MA_10328934g0010
MA_8045151g0010MA_112946g0010
Populus trichocarpaPotri.004G234100.1Potri.015G145400.1Potri.012G142300.1Potri.012G142300.2Potri.012G142300.3
Potri.012G142300.4Potri.005G001500.1Potri.004G233900.4Potri.004G233900.3Potri.004G233900.1
Potri.013G000900.1Potri.003G046200.1Potri.014G110900.1Potri.010G004400.2Potri.003G046200.2
Potri.010G004400.1Potri.004G233900.2Potri.006G084900.2Potri.006G084900.1Potri.005G001500.2
Potri.004G233900.5Potri.006G084900.3Potri.003G046200.3.135.342Potri.003G046200.3.135.342Potri.003G046200.3.25.135
Potri.003G046200.3.25.135Potri.002G185600.1
Prunus persicappa006687mppa006668mppa006446mppa018641mppa006114m
ppa005949mppa006038mppa006718mppa007506mppa007661m
ppa019564m
Ricinus communis29827.m00262830169.m00625330128.m00899129846.m00018929827.m002629
30076.m004531
Setaria italicaSi022068mSi001581mSi005040mSi002381mSi004669m
Si002066mSi029986mSi001489mSi010270mSi001624m
Si001587mSi001540mSi002079mSi017839mSi002101m
Si018011mSi002805mSi035785m.201.409Si035785m.201.409Si035783m.201.409
Si035783m.201.409Si002361mSi035785m.39.182Si035785m.39.182Si035783m.39.182
Si035783m.39.182Si002502m.155.257Si002502m.155.257Si003167m
Selaginella moellendorffii1103354473821186287805883208
27137182014
Sorghum bicolorSb04g030720.1Sb09g001350.1Sb03g013070.2Sb03g047440.1Sb02g040470.1
Sb03g013080.1Sb06g027560.1Sb03g013070.1Sb03g007930.1Sb03g042380.1
Sb01g029710.1Sb03g042400.1.25.136Sb03g042400.1.25.136Sb03g042400.1.170.334Sb03g042400.1.170.334
Thellungiella halophilaThhalv10025385mThhalv10024796mThhalv10020789mThhalv10000914mThhalv10020818m
Thhalv10004301mThhalv10001449mThhalv10004254mThhalv10004253mThhalv10004218m
Thhalv10005997mThhalv10023485mThhalv10029387m
Vitis viniferaGSVIVT01036914001GSVIVT01028921001GSVIVT01034178001GSVIVT01028231001GSVIVT01028230001
GSVIVT01031342001GSVIVT01017717001
Zea maysAC204604.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)