y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g41860.1
FamilyAA1
Protein PropertiesLength: 545 Molecular Weight: 59793 Isoelectric Point: 6.8273
ChromosomeChromosome/Scaffold: 18 Start: 50829337 End: 50835240
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1225300
  AAIVEYTFKVQTTTVNRLCNKRVIVTVNGQFPGPNINVSEGDTVVVHLLNEGPYNITIHWHGVLQLFTAWADGPEYVTQCPISPGNNYTYTFNATRQEGT
  LWWHAHASVLRATVHGAFIIQPRSGRFPFPKPYKQVPIILGDWYDANNVVDIETQALATGGSPNISSAFTINGLPGDLFSCSQNQKFTMSVTQGKTYMLR
  MINAALNNHLFFKIANHTFTVVAMDAAYTDHYVTNIIVIAPGQTIDALFTADQPLGSYYMAASPYIVGVPVFDNTTTRGVVVYDNAPPSSSQPLMPTLPP
  FGDTETAHKFYSNITGKVGAPHWIPVPTTVDEHMFSSSMNNESFVLPIGRGFSMLEAFFKNVSGVYTADFPDNPPVTFDFANPSISFDPNLLFAPKSTKV
  KKLKFNSTVEVVFQNTAILGVQNHPMHVHGFSFHVLAQGFGNFNSTTDSTKFNLVNPQLRNTIAVPVGGWAVIRFQANNPGVWFVHCHIEDHVPWGLNMA
  FEVENGPTS
Full Sequence
Protein Sequence     Length: 545     Download
MKLFMFLLAW AFALLGSSLA SAAIVEYTFK VQTTTVNRLC NKRVIVTVNG QFPGPNINVS    60
EGDTVVVHLL NEGPYNITIH WHGVLQLFTA WADGPEYVTQ CPISPGNNYT YTFNATRQEG    120
TLWWHAHASV LRATVHGAFI IQPRSGRFPF PKPYKQVPII LGDWYDANNV VDIETQALAT    180
GGSPNISSAF TINGLPGDLF SCSQNQKFTM SVTQGKTYML RMINAALNNH LFFKIANHTF    240
TVVAMDAAYT DHYVTNIIVI APGQTIDALF TADQPLGSYY MAASPYIVGV PVFDNTTTRG    300
VVVYDNAPPS SSQPLMPTLP PFGDTETAHK FYSNITGKVG APHWIPVPTT VDEHMFSSSM    360
NNESFVLPIG RGFSMLEAFF KNVSGVYTAD FPDNPPVTFD FANPSISFDP NLLFAPKSTK    420
VKKLKFNSTV EVVFQNTAIL GVQNHPMHVH GFSFHVLAQG FGNFNSTTDS TKFNLVNPQL    480
RNTIAVPVGG WAVIRFQANN PGVWFVHCHI EDHVPWGLNM AFEVENGPTS STSLPPPPSD    540
LPKC*                                                                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_38.0e-4830146119+
PLN02191PLN021912.0e-6524522548+
PLN02604PLN026044.0e-8240523531+
TIGR03388ascorbase1.0e-8425523549+
TIGR03389laccase027527525+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABC59623.102654426571putative copper ion-binding laccase [Pisum sativum]
EMBLCBI30455.101754417542unnamed protein product [Vitis vinifera]
RefSeqXP_002276415.101754417565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308196.1015441562laccase 110a [Populus trichocarpa]
RefSeqXP_002527888.10295442540laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0225221521A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1asq_A0225221521A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1asp_B0225221521A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1asp_A0225221521A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1aso_B0225221521A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE591979562265270
HO797675479755270
DY294561301243220
FC884996261242830
FS330105242252620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi4g11850.1
Bradi3g45190.1Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1
Bradi4g11840.1Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma01g26750.2Glyma07g17170.1
Glyma18g41886.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)