y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g42540.1
FamilyGT4
Protein PropertiesLength: 516 Molecular Weight: 57677.9 Isoelectric Point: 9.5301
ChromosomeChromosome/Scaffold: 18 Start: 51689995 End: 51695226
Descriptionsulfoquinovosyldiacylglycerol 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43074588.1e-38
  NDEPDKPLIIHVGRLGVEKSLDFLKRLMDRLPDARIAFVGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGIP
  VVAARAGGIPDIIPADQDGKTSYLYDPGDLEDCLSKLRPLLHNKELRETMGK
Full Sequence
Protein Sequence     Length: 516     Download
MKTTAITINP SLSPPFCSKA TTPPSCSSSS SSFPPSFPRF HLSGAKPISL SCRGTRLCFL    60
KGSKTLWGRK SFVLGAGNMT MAEVDSHEEG ENEGALVGSE NENNSRPRRI ALFVEPSPFA    120
YVSGYKNRFQ NFIRCLREMG DEVMVVTTHE GVPQEFYGAK LIGSWSFPCP LYQKVPLSLA    180
LSPRIISEVA RFKPDIIHAS SPGIMVFGAL IIAKLLCVPI VMSYHTHVPV YIPRYTFSWL    240
VKPMWLIIKF LHRAADLTLV PSAAIAGDLL AARVTAANKI RLWNKGVDSE KFHPKYRSHE    300
MRLRLSNDEP DKPLIIHVGR LGVEKSLDFL KRLMDRLPDA RIAFVGDGPY REELEKMFEG    360
MPAVFTGMLG GEELSQAYAS GDVFVMPSES ETLGFVVLEA MSSGIPVVAA RAGGIPDIIP    420
ADQDGKTSYL YDPGDLEDCL SKLRPLLHNK ELRETMGKAA REEMEKYDWK AATRKIRNEQ    480
YNAAIWFWRK KRAQLLRPFQ RLAKHFFPSP QVNYR*                              540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like4.0e-52110484395+
cd03801GT1_YqgM_like1.0e-69109477379+
TIGR00032argG2.0e-71109468373+
TIGR00009L283.0e-125109481376+
PLN02871PLN02871053514462+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA55726.1035096512sulfoquinovosyldiacylglycerol synthase type 2 [Vigna unguiculata]
RefSeqXP_002278868.1010451525436PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309122.10775112433predicted protein [Populus trichocarpa]
RefSeqXP_002323560.10885125429predicted protein [Populus trichocarpa]
RefSeqXP_002531354.1010050222424glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.00000000000000613646440365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.00000000000000613646440365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.00000000000000613646440365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.00000000000000613646440365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.00000000000000613646440365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8131183191574750
DV7116653011874870
DC8855572861674520
CO088719291883780
DV1053482781534300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00305.1Aquca_053_00022.3Aquca_053_00022.2Aquca_053_00022.1
Arabidopsis lyrata860579323188
Arabidopsis thalianaAT5G01220.1AT3G45100.2AT3G45100.1
Brachypodium distachyonBradi1g59860.1Bradi2g02800.1Bradi1g67200.1Bradi1g32610.1
Brassica rapaBra009633Bra005694Bra009589
Carica papayaevm.model.supercontig_163.3evm.model.supercontig_65.21
Capsella rubellaCarubv10000742mCarubv10019008m
Chlamydomonas reinhardtiiCre01.g038550.t1.3Cre16.g689150.t1.2Cre01.g006800.t1.3
Citrus clementinaCiclev10011473mCiclev10001141mCiclev10001076m
Citrus sinensisorange1.1g022615morange1.1g017114morange1.1g016648morange1.1g009759morange1.1g027511m
Cucumis sativusCucsa.176160.1Cucsa.143020.1
Eucalyptus grandisEucgr.A00516.1Eucgr.J00902.1
Fragaria vescamrna18817.1-v1.0-hybridmrna24819.1-v1.0-hybrid
Glycine maxGlyma03g14200.1Glyma01g27840.1Glyma07g17680.4Glyma07g17680.3Glyma07g17680.2
Glyma07g17680.1Glyma20g12140.9Glyma20g12140.8Glyma20g12140.7Glyma20g12140.6
Glyma20g12140.5Glyma20g12140.4Glyma20g12140.3Glyma20g12140.2Glyma20g12140.10
Glyma13g25060.1
Gossypium raimondiiGorai.012G112200.2Gorai.012G112200.1Gorai.002G261700.2Gorai.002G261700.6Gorai.002G261700.4
Gorai.002G261700.3Gorai.002G261700.1Gorai.003G143800.9Gorai.003G143800.8Gorai.003G143800.7
Gorai.003G143800.6Gorai.003G143800.5Gorai.003G143800.4Gorai.003G143800.3Gorai.003G143800.2
Gorai.003G143800.10Gorai.003G143800.1
Linum usitatissimumLus10004832Lus10002499Lus10024892Lus10022925
Malus domesticaMDP0000899469MDP0000143617MDP0000297386MDP0000273680MDP0000203472
MDP0000184748MDP0000198677
Manihot esculentacassava4.1_007989mcassava4.1_005643mcassava4.1_032287m
Medicago truncatulaMedtr4g015260.1Medtr7g067340.1
Mimulus guttatusmgv1a004620mmgv1a004551mmgv1a006150mmgv1a006148m
Oryza sativaLOC_Os01g04920.1LOC_Os07g01030.1LOC_Os03g15840.1LOC_Os07g16960.1
Panicum virgatumPavirv00011082mPavirv00023556mPavirv00064963mPavirv00000330mPavirv00022111m
Pavirv00063251mPavirv00030308mPavirv00006595mPavirv00056553mPavirv00006877m
Physcomitrella patensPp1s24_194V6.1Pp1s106_103V6.1
Phaseolus vulgarisPhvul.010G005100.1Phvul.008G106900.1Phvul.005G132400.1Phvul.002G226400.1
Picea abiesMA_158718g0080MA_60607g0010MA_159042g1330MA_159118g0680MA_159090g0090
MA_159042g1140
Populus trichocarpaPotri.016G112600.4Potri.016G112600.3Potri.016G112600.2Potri.016G112600.1Potri.006G097600.3
Potri.006G097600.2Potri.006G097600.1Potri.016G130000.1
Prunus persicappa004263mppa005676mppa018035m
Ricinus communis35899.m00002429969.m00027234675.m00002848584.m00001330418.m000015
32791.m00002229638.m00053127698.m000067
Setaria italicaSi020690mSi001496mSi035897mSi035683m
Selaginella moellendorffii170091406541
Sorghum bicolorSb02g000240.1Sb03g006480.1Sb01g040150.1Sb02g008800.1
Thellungiella halophilaThhalv10013276mThhalv10002532m
Vitis viniferaGSVIVT01033998001GSVIVT01024777001
Volvox carteriVocar20009459mVocar20001320m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)