y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g45226.1
FamilyGT8
Protein PropertiesLength: 628 Molecular Weight: 71189 Isoelectric Point: 8.0946
ChromosomeChromosome/Scaffold: 18 Start: 54988072 End: 54997403
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT83055990
  CLSLKLTVEYFKSSHNDEKADEEKFIDSSLHHYVIFSNNVLAASVVINSTVFHAKESSNLVFHVLTDGENYYAIKLWFLRNHYKEAAVQVLNVELDSQKE
  NPLLLSLPEEFRISFRDNPSRNRIRTEYLSIFSDSHYLLPHLFSNLNKVVVLDDDVVIQQDLSALWNIDLGHKVNGAVQFCSVKLGKLKSYLGEKGFSQN
  SCAWMSGLNIIDLVRWRELGLTQTYRKLIKEFTMQEGSVEGIAWRASLLTFENEIYPLNESWVVSGMGHDYTIGTQPIKTASVLHYNGKMKPWLD
Full Sequence
Protein Sequence     Length: 628     Download
MKSGGGGGGG MGAVPSYGVP AKRRWRGLVI AVLGLVILSM LVPLVFLLGL HNGFHSSGYI    60
YEQKNTPSNE KSLERYDRHD VGHNESEGEQ SSHVEDLITK FEPTLPKDVL KKYTREGKSD    120
KQRGSRAPPK GVLQSPPTSN SPRSGQIEQV NNPKTSSTDE GGKSCELTFG SYCLWQQEHR    180
QEMKDALVKK LKDQLFVARA YYPSLAKLPA NDKLSRQLKQ NIQEMEHMLS ESTTDADLPP    240
VAESYSKKME KTITRVKSIP VVCDNVDKKL RQIFDLTEDE ANFHMKQSAF LYKLNVQTMP    300
KSHHCLSLKL TVEYFKSSHN DEKADEEKFI DSSLHHYVIF SNNVLAASVV INSTVFHAKE    360
SSNLVFHVLT DGENYYAIKL WFLRNHYKEA AVQVLNVELD SQKENPLLLS LPEEFRISFR    420
DNPSRNRIRT EYLSIFSDSH YLLPHLFSNL NKVVVLDDDV VIQQDLSALW NIDLGHKVNG    480
AVQFCSVKLG KLKSYLGEKG FSQNSCAWMS GLNIIDLVRW RELGLTQTYR KLIKEFTMQE    540
GSVEGIAWRA SLLTFENEIY PLNESWVVSG MGHDYTIGTQ PIKTASVLHY NGKMKPWLDL    600
GIPQYKSYWK KFLNKEDHLL SECNVNS*                                       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_11.0e-76335614289+
PLN02718PLN027186.0e-8822627638+
PLN02910PLN029103.0e-91170626490+
PLN02829PLN028295.0e-10258626602+
PLN02769PLN02769016626635+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08312.1096274645Glycosyl transferase, family 8 [Medicago truncatula]
EMBLCAQ58617.1015662657540transferase, transferring glycosyl groups / unknown protein [Vitis vinifera]
RefSeqXP_002264525.105262648612PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323701.10144626131619glycosyltransferase, CAZy family GT8 [Populus trichocarpa]
RefSeqXP_002519984.1015162685575Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.00000842859774252A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1g9r_A0.00000842859774252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.00013385973252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan biosynthesis2.4.1.43-RXNEC-2.4.1.43polygalacturonate 4-α-galacturonosyltransferase
Transmembrane Domains
StartEnd
2850
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7854493053136150
CA9387921942594520
EX2882353271935170
BG5884022473876280
FG8815692323826110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)