y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g50080.1
FamilyGT1
Protein PropertiesLength: 449 Molecular Weight: 50553.1 Isoelectric Point: 6.2353
ChromosomeChromosome/Scaffold: 18 Start: 59307795 End: 59310530
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12514235.2e-32
  EDTTCLHWLDQHPPQSVVYVSFGSLAIVEPNQFNELAIGLDLLNKPFLWVVRPSNENNKVNNTYPNEFHGSKGKIIGWAPQKKILNHPAIACFITHCGWN
  SIIEGVCGGIPFLCWPFFSDQFINKSYICDVWKVGLGLDQDENGLIMKGEIRKKVEQLLGNEDIKARSVKLKE
Full Sequence
Protein Sequence     Length: 449     Download
MSYPHFLVMP YPILGHMNPL LQFSQVLANH GCKITFLITE FNQKRMKSEI DHLGAQIKFV    60
TLPDGLDPED DRSDQPKVIL SLRNTMPTKL HRLIQDINNN NNALDGDNNK ITCLVVSKNI    120
GWALEVAHKL GIKGALLWPA SATSLASFES IPRLIDEGII DSETGLPTRK QEIQLLPNSP    180
MMDTANLPWC SLGKNFFLHM VEDTQSLKLG EWWLCNTTCD LEPGALAMWP RFLSIGPLMQ    240
SDTNKSSFWR EDTTCLHWLD QHPPQSVVYV SFGSLAIVEP NQFNELAIGL DLLNKPFLWV    300
VRPSNENNKV NNTYPNEFHG SKGKIIGWAP QKKILNHPAI ACFITHCGWN SIIEGVCGGI    360
PFLCWPFFSD QFINKSYICD VWKVGLGLDQ DENGLIMKGE IRKKVEQLLG NEDIKARSVK    420
LKELTVNNFD EGGQSSQNIE KFINWAKD*                                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02210PLN022103.0e-545444472+
PLN02448PLN024483.0e-555444463+
PLN02410PLN024102.0e-577447462+
PLN02555PLN025554.0e-622444483+
PLN02562PLN025627.0e-771444477+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU24307.1014481456unknown [Glycine max]
GenBankACZ74668.1014431455UDP-glucosyl transferase [Phaseolus vulgaris]
RefSeqXP_002276804.1014471453PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306070.1014471455predicted protein [Populus trichocarpa]
RefSeqXP_002526117.1054456455UDP-glucuronosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A044439474A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A044247442A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A044247442A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A044247442A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbj_A4.00001e-40544315449A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
daidzein conjugates interconversionRXN-3584EC-2.4.1.170isoflavone 7-O-glucosyltransferase
formononetin conjugates interconversionRXN-4761EC-2.4.1.170isoflavone 7-O-glucosyltransferase
genistein conjugates interconversionRXN-3581EC-2.4.1.170isoflavone 7-O-glucosyltransferase
maackiain conjugates interconversionRXN-4319EC-2.4.1.170isoflavone 7-O-glucosyltransferase
medicarpin conjugates interconversionRXN-4201EC-2.4.1.170isoflavone 7-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63126746314490
GR8474072221543750
GO0297202232254470
FG8700282032034050
GR847407423764170.0000000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00437.1Aquca_006_00442.1.683.867Aquca_006_00442.1.683.867Aquca_006_00439.1Aquca_1448_00001.1
Aquca_008_00220.1Aquca_002_00805.1Aquca_006_00438.1Aquca_006_00438.2Aquca_002_00813.1
Aquca_002_00811.1Aquca_006_00440.1Aquca_002_00814.1Aquca_002_00807.1Aquca_002_00812.1
Aquca_006_00441.1Aquca_006_00442.1.250.430Aquca_006_00442.1.250.430Aquca_014_00439.1Aquca_002_00808.1
Arabidopsis lyrata871488
Arabidopsis thalianaAT3G02100.1
Brachypodium distachyonBradi1g08157.1Bradi1g08177.1Bradi4g15800.1Bradi1g08190.1Bradi1g08150.1
Bradi1g08140.1Bradi1g08145.1Bradi3g17476.1Bradi1g63927.1
Brassica rapaBra039152
Carica papayaevm.TU.contig_41702.1
Capsella rubellaCarubv10013680m
Citrus clementinaCiclev10000944mCiclev10001112mCiclev10001080mCiclev10001067mCiclev10000928m
Ciclev10028395mCiclev10028394mCiclev10012482mCiclev10024412mCiclev10030167m
Ciclev10001071mCiclev10013686mCiclev10020076mCiclev10001095mCiclev10023795m
Ciclev10020077mCiclev10019991mCiclev10012136mCiclev10023293m
Citrus sinensisorange1.1g047662morange1.1g012652morange1.1g012083morange1.1g012314morange1.1g010617m
orange1.1g009851morange1.1g044266morange1.1g012212morange1.1g012744morange1.1g048435m
orange1.1g012594morange1.1g017266morange1.1g042709m
Cucumis sativusCucsa.221580.1
Eucalyptus grandisEucgr.B00577.1Eucgr.H02732.1.617.825Eucgr.H02732.1.617.825Eucgr.K02513.1Eucgr.K02516.1
Eucgr.H02732.1.188.390Eucgr.H02732.1.188.390Eucgr.K02510.1Eucgr.K02515.1Eucgr.H02711.1
Eucgr.H02712.1Eucgr.K02512.1Eucgr.H02703.1Eucgr.H02730.1Eucgr.H02704.1
Fragaria vescamrna04292.1-v1.0-hybridmrna04291.1-v1.0-hybridmrna04290.1-v1.0-hybridmrna25784.1-v1.0-hybridmrna25795.1-v1.0-hybrid
Glycine maxGlyma08g26840.1Glyma18g50110.2Glyma18g50110.1Glyma13g06170.1Glyma19g03600.1
Glyma05g04196.1Glyma19g03580.1Glyma18g50100.1Glyma13g06151.1Glyma08g26790.1
Glyma19g03611.1.284.406Glyma19g03611.1.284.406Glyma08g26830.1Glyma18g50090.1Glyma01g21590.1
Glyma19g03620.1Glyma08g26780.1Glyma18g50060.1Glyma01g21580.1Glyma01g21620.1
Glyma19g03611.1.66.202Glyma19g03611.1.66.202
Gossypium raimondiiGorai.007G082200.1Gorai.007G082200.3Gorai.007G082200.2Gorai.007G145900.1Gorai.012G048900.1
Gorai.008G197600.2Gorai.008G197600.1Gorai.008G197800.1Gorai.006G010800.1Gorai.007G145900.2
Gorai.008G197700.1
Linum usitatissimumLus10015746Lus10015750Lus10015751Lus10015753Lus10015745
Lus10003454Lus10003452Lus10034699Lus10003455Lus10015744
Lus10015749Lus10003453Lus10040533Lus10015748
Malus domesticaMDP0000176250MDP0000280885MDP0000302810MDP0000586116MDP0000592879
MDP0000230836MDP0000280886MDP0000270051MDP0000164967MDP0000322091
MDP0000772835
Manihot esculentacassava4.1_024855mcassava4.1_007374mcassava4.1_026903mcassava4.1_007626mcassava4.1_028065m
cassava4.1_022325mcassava4.1_031794mcassava4.1_030150mcassava4.1_024809mcassava4.1_023170m
cassava4.1_007623mcassava4.1_008181mcassava4.1_027192m
Medicago truncatulaMedtr7g013240.1Medtr7g013260.1Medtr7g013220.1Medtr7g013180.1Medtr7g013200.1
Mimulus guttatusmgv1a011424mmgv1a020666mmgv1a024777mmgv1a024506mmgv1a005998m
mgv1a012622m
Oryza sativaLOC_Os03g55010.1LOC_Os03g55030.2LOC_Os03g55030.1LOC_Os03g55050.1LOC_Os03g55020.1
LOC_Os10g17489.1LOC_Os10g18480.1LOC_Os10g18510.1LOC_Os03g55040.1LOC_Os10g18530.1
Panicum virgatumPavirv00049650mPavirv00010952mPavirv00064071mPavirv00056062mPavirv00003314m
Pavirv00032986mPavirv00009335mPavirv00059277mPavirv00056481mPavirv00061026m
Pavirv00061669mPavirv00029458mPavirv00004995mPavirv00004994mPavirv00062864m
Pavirv00052493mPavirv00052492mPavirv00058440mPavirv00062863mPavirv00052495m
Pavirv00056955mPavirv00056130mPavirv00025868mPavirv00007292m
Physcomitrella patensPp1s4_21V6.1Pp1s6_30V6.1Pp1s77_100V6.1
Phaseolus vulgarisPhvul.004G035300.1Phvul.004G035900.1Phvul.004G035700.1Phvul.004G035600.1Phvul.008G034300.1
Phvul.004G035800.1Phvul.004G036000.1Phvul.008G034200.1Phvul.008G034000.1Phvul.008G034100.1
Phvul.004G035500.1Phvul.008G035800.1Phvul.004G037100.1Phvul.004G036100.1Phvul.004G037000.1
Picea abiesMA_5333g0010MA_243g0020MA_10143270g0010MA_10165844g0010MA_134288g0010
MA_729922g0010MA_186971g0010MA_6422g0010MA_141053g0010MA_216575g0010
MA_10267586g0010MA_10426068g0020MA_69857g0010MA_4906g0020MA_9996672g0010
MA_19633g0010MA_119297g0010MA_671328g0010MA_192708g0010MA_10428499g0010
MA_28597g0010MA_870509g0010MA_79587g0010MA_10427763g0010.118.248MA_10427763g0010.118.248
MA_7388392g0010MA_10427763g0010.250.403MA_10427763g0010.250.403MA_376741g0010MA_44898g0020
MA_10431252g0010.257.402MA_10431252g0010.257.402MA_94043g0020MA_573449g0010MA_10426068g0010
MA_193320g0010MA_517290g0010MA_490343g0010MA_636498g0010MA_448717g0010
Populus trichocarpaPotri.017G091500.1Potri.010G084900.1Potri.004G123500.1Potri.004G119700.1Potri.013G022800.1
Prunus persicappa020470mppa006338mppa020867mppa019116mppa022508m
Ricinus communis29630.m00082829630.m00081730138.m00400030138.m00399429630.m000829
29630.m00081930138.m003997
Setaria italicaSi035615mSi035596mSi035605mSi039070mSi040036m
Si039735mSi035607mSi039435mSi035614mSi017089m
Si035627mSi035316mSi040193mSi040038mSi040112m
Si038689m
Selaginella moellendorffii10077111448111464111636111188
153665111946183183111739178031
4073122352939539816795795612
131108844239576584376447950
16235411588623122395938448116
4479496400084049177347430669.230.405
430669.230.4059559610430383942143651
2334882277841210985053102508
41752622903233672173967127526
4195792714598469513489912643
4127454384144062995957410681
1867671607242049179380128107
1779436393812803212791584680
419489412105441500168007407356
44046884016960268438797269
11011444170268664231443416242
9546415329430671430669.712.851430669.712.851
916322724315423411023
Sorghum bicolorSb01g007640.1Sb01g007630.1Sb05g005880.1Sb07g003850.1Sb01g007610.1
Sb01g007600.1Sb01g004090.1Sb01g007620.1
Thellungiella halophilaThhalv10020693m
Vitis viniferaGSVIVT01007898001.535.724GSVIVT01007898001.535.724GSVIVT01032927001GSVIVT01007898001.113.285GSVIVT01007898001.113.285
GSVIVT01032925001GSVIVT01032930001GSVIVT01032926001GSVIVT01012978001GSVIVT01007899001
GSVIVT01007892001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)