y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g53823.1
FamilyGT48
Protein PropertiesLength: 1959 Molecular Weight: 225536 Isoelectric Point: 9.5094
ChromosomeChromosome/Scaffold: 18 Start: 62079452 End: 62111100
Descriptionglucan synthase-like 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48105918140
  VPSNLEARRRISFFSNSLFMDMPMAPKVRNMLSFSVLTPYYTEEVLFSLNDLDSQNEDGVSILFYLQKIFPDEWNNFLERVNSTEEDIKGSESDELVEEL
  RLWASYKGQTLTRTVRGMMYYRKALELQAFLDMAKDEDLMEGYKAMENSDDNSRGERSLWTQCQAVADMKFTYVVSCQQYGIDKRSGSPRAQDILRLMTR
  YPSLRVAYIDEVEEPVKDSKKKINKVYYSCLVKAMPKSNIPSEPERNLDQIIYKIKLPGPAILGEGKPENQNHAIIFTRGEGLQTIDMNQDNYMEEALKM
  RNLLQEFLKKHDGVRFPSILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRLLANPLKVRFHYGHPDVFDRLFHLTRGGVSKASKVINLSEDIFAGFNST
  LREGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDVYRLGHRFDFFRMLSCYFTTVGFYFSTLITVLTVYVFLYGRLYLVLSGLEEGLSTQ
  KAIRDNKPLQVALASQSFVQIGVLMALPMLMEIGLERGFRTALSEFILMQLQLAPVFFTFSLGTKTHYFGRTLLHGGAKYRPTGRGFVVFHAKFADNYRL
  YSRSHFVKGIELMILLVVYQIFGHSYRSTVAYILITASMWFMVGTWLFAPFLFNPSGFEWQKIVDDWTDWNKWISNRGGIGVPPEKSWESWWEEEQEHLQ
  YSGMRGIIVEILLSLRFFIYQYGLVYHLNITKKGPKSFLVYGISWLVIFVILFVMK
Full Sequence
Protein Sequence     Length: 1959     Download
MSSSRGGAGP SSEAPPPRRI MRTQTAGNLG ESVIDSEVVP SSLVEIAPIL RVANEVEKTH    60
PRVAYLCRFY AFEKAHRLDP NSSGRGVRQF KTALLQRLER ENDPTLKGRV KKSDAREMQS    120
FYQHYYKKYI QALQNAADKA DRAQLTKAYN TANVLFEVLK AVNMTQSMEV DREILETQDK    180
VAEKTEILVP YNILPLDPDS ANQAIMRFPE IQAAVYALRN TRGLPWPKDY KKKKDEDILD    240
WLGSMFGFQK HNVANQREHL ILLLANVHIR QFPKPDQQPK LDERALTEVM KKLFKNYKKW    300
CKYLGRKSSL WLPTIQQEVQ QRKLLYMGLY LLIWGEAANL RFMPECLCYI YHHMAFELYG    360
MLAGNVSPMT GENVKPAYGG EEEAFLRKVV TPIYNVIAKE AARSKKGRSK HSQWRNYDDL    420
NEYFWSADCF RVGWPMRADA DFFCLPAEKL VFDKSNDDKP PSRDRWVGKV NFVEIRSFWH    480
MFRSFDRMWS FFILCLQAMI IVAWNGSGDP SAIFNGDVFK KALSVFITAA ILKFGQAVLD    540
VILSWKAQQS MSLYVKLRYI LKVVSAAAWV IVLSVTYAYT WDNPPGFAQT IKSWFGSGGS    600
SSPSLFILAV VVYLSPNMLA AIFFLIPFIR RHLERSNYRI VMLMMWWSQP RLYVGRGMHE    660
SAFSLFKYTM FWILLIITKL AFSYYIEIKP LVGPTKAIMS VKITIFQWHE FFPHARNNIG    720
VVIALWAPII LVYFMDTQIW YAIFSTLFGG VYGAFRRLGE IRTLGMLRSR FQSLPGAFNA    780
SLIPEETNEP KKKGLKATLS RRFPEISSNK GKEAARFAQL WNQIITSFRD EDLIDDREMN    840
LLLVPYWADT QLDLIQWPPF LLASKIPIAL DMAKDSNGKD RELKKRIAAD NYMSCAVREC    900
YASFKSIIKH LVQGEREIPV IEYMFNEVDK HIESDKLISE FKMSALPILY GQFVELIQYL    960
LTNDPKDRDR VVLLFQDMLE VVTRDIMMED QDQIFSLVDS SHGGTGHEGM LHLEPEPHHQ    1020
LFASEGAIKF PIEPLTAAWT EKIKRLHLLL TTKESAMDVP SNLEARRRIS FFSNSLFMDM    1080
PMAPKVRNML SFSVLTPYYT EEVLFSLNDL DSQNEDGVSI LFYLQKIFPD EWNNFLERVN    1140
STEEDIKGSE SDELVEELRL WASYKGQTLT RTVRGMMYYR KALELQAFLD MAKDEDLMEG    1200
YKAMENSDDN SRGERSLWTQ CQAVADMKFT YVVSCQQYGI DKRSGSPRAQ DILRLMTRYP    1260
SLRVAYIDEV EEPVKDSKKK INKVYYSCLV KAMPKSNIPS EPERNLDQII YKIKLPGPAI    1320
LGEGKPENQN HAIIFTRGEG LQTIDMNQDN YMEEALKMRN LLQEFLKKHD GVRFPSILGL    1380
REHIFTGSVS SLAWFMSNQE TSFVTIGQRL LANPLKVRFH YGHPDVFDRL FHLTRGGVSK    1440
ASKVINLSED IFAGFNSTLR EGNVTHHEYI QVGKGRDVGL NQISMFEAKI ANGNGEQTLS    1500
RDVYRLGHRF DFFRMLSCYF TTVGFYFSTL ITVLTVYVFL YGRLYLVLSG LEEGLSTQKA    1560
IRDNKPLQVA LASQSFVQIG VLMALPMLME IGLERGFRTA LSEFILMQLQ LAPVFFTFSL    1620
GTKTHYFGRT LLHGGAKYRP TGRGFVVFHA KFADNYRLYS RSHFVKGIEL MILLVVYQIF    1680
GHSYRSTVAY ILITASMWFM VGTWLFAPFL FNPSGFEWQK IVDDWTDWNK WISNRGGIGV    1740
PPEKSWESWW EEEQEHLQYS GMRGIIVEIL LSLRFFIYQY GLVYHLNITK KGPKSFLVYG    1800
ISWLVIFVIL FVMKTVSVGR RKFSANFQLV FRLIKGMIFL TFVSILVILI ALPHMTVLDI    1860
VVCILAFMPT GWGMLQIAQA LKPVVRRAGF WGSVKTLARG YEIVMGLLLF TPVAFLAWFP    1920
FVSEFQTRML FNQAFSRGLQ ISRILGGQRK ERSSRNKE*                           1980
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6055.0e-946160120+
pfam14288FKS1_dom15.0e-58321437118+
pfam02364Glucan_synthase010591810832+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI16456.103195821948unnamed protein product [Vitis vinifera]
Swiss-ProtQ9LXT901195811964CALS3_ARATH RecName: Full=Callose synthase 3; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 12
RefSeqXP_002283298.103195821947PREDICTED: similar to Callose synthase 3 [Vitis vinifera]
RefSeqXP_002299147.101195811940predicted protein [Populus trichocarpa]
RefSeqXP_002528124.103195821955transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lxm_A0.0035015921128B Chain B, Lip5-chmp5
PDB2lxl_A0.0035015921128A Chain A, Lip5(mit)2
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
489508
523545
557579
607629
664686
712734
739756
15191541
15671589
16041621
16581680
16901712
17641786
17961818
18301852
18571879
19001922
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7836344934219110
HO780496341138217220
HO780496133124913810
HO780496206170719120
HO79776437879111680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma08g47670.1Glyma08g47670.2
Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6Glyma18g13105.10
Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)