y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g05450.1
FamilyCE10
Protein PropertiesLength: 416 Molecular Weight: 46471.3 Isoelectric Point: 8.5364
ChromosomeChromosome/Scaffold: 19 Start: 5918648 End: 5925410
Descriptionprenylcysteine methylesterase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101163640
  VKRSIVYGDQPRNRLDLYLPANIGEPKPVLIFVTGGAWIIGYKAWGSLLGLQLAERGIMVACIDYRNFPQGTISDMVNDTSRGISFIINNIANYGGDPNR
  IYLMGQSAGAHISSCALLEQAARESEKEDSVSWSISQLKAYLGLSGGYNLLDLVDHFHNRGLDRSIFLSIMEGENSLKEFSPEIKIQDPCLKSSIPHFPP
  VYLVHGTADYSIPSVASERFAEALKKAGVRAELILYEGKTHTDLFLQDP
Full Sequence
Protein Sequence     Length: 416     Download
MATLSDHRRR MLPPENVDAQ PITSDSVSNN HRTTHRRDAG NNGLRHRLVR QESLRRNIEH    60
VAAETYLVSR LAFTLLRYLG IGYRWITQLL ALGCYAMLLM PGFLQVAYYY FFTSKVKRSI    120
VYGDQPRNRL DLYLPANIGE PKPVLIFVTG GAWIIGYKAW GSLLGLQLAE RGIMVACIDY    180
RNFPQGTISD MVNDTSRGIS FIINNIANYG GDPNRIYLMG QSAGAHISSC ALLEQAARES    240
EKEDSVSWSI SQLKAYLGLS GGYNLLDLVD HFHNRGLDRS IFLSIMEGEN SLKEFSPEIK    300
IQDPCLKSSI PHFPPVYLVH GTADYSIPSV ASERFAEALK KAGVRAELIL YEGKTHTDLF    360
LQDPLRGGKD DLFDLAVAIM HSNDSDALAN DAIAPPRRRF VPEILLKLAR KISPF*        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00135COesterase5.0e-8132238123+
cd00312Esterase_lipase2.0e-8130238124+
COG2272PnbA4.0e-12130233119+
pfam07859Abhydrolase_38.0e-15145356218+
COG0657Aes5.0e-27120356246+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD96862.104741560427hypothetical protein [Cleome spinosa]
RefSeqNP_197090.20141517427ATPCME (PRENYLCYSTEINE METHYLESTERASE); prenylcysteine methylesterase [Arabidopsis thaliana]
RefSeqXP_002264962.10124158417PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002277990.102141567458PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329262.105141513377predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1lzl_A0.000000000112535662290A Chain A, Bacterial Heroin Esterase
PDB1lzk_A0.000000000112535662290A Chain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid
PDB2hm7_A0.000000000212935661282A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1u4n_A0.000000000212935661282A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1qz3_A0.000000000212935661282A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate
Transmembrane Domains
StartEnd
89111
144166
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9843472311864160
DY280956327153360
DY288531313153220
DY270152298153070
GE479256299833800
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)