y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g05550.2
FamilyGH81
Protein PropertiesLength: 738 Molecular Weight: 82796.7 Isoelectric Point: 7.4433
ChromosomeChromosome/Scaffold: 19 Start: 6068202 End: 6071303
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81737140
  VVPEPSNFFSSNLVSNPLPTNSFFQNFVLKNGDQPEYIHPYLIKSSNSCLSLSYPSRFMNPSFIYQVFNPDLTISSSQKSHPSHLNHTISSHNDLSVTLD
  IPSSNLRFFLVRGSPFLTLSVTQPTPLSITTIHAILSFTSSESLTKHTFHLNNGQTWFLYASSPIRLSHGLSEITSDAFSGIIRIALLPGSDWKHEAVLD
  RFSSCYPVSGEAVFARPFCVEYKWEKRGWGDLLMLAHPLHIQLLADSGSEDVSVLSDFKYGSIDGELVGVVGDSWLLKTDPVSVTWHSVRGVREESRDEV
  VSALVNDVEGLNSSAIATNSSYFYGKLVARAARFALIAEEVCFLDVIPKVRKYLKETIEPWLEGTFNGNGFLYDRKWGGIVTKQGSTDAGADFGFGVYND
  HHYHLGYFLYGIAVLAKIDPVWGRKYKPQAYSLMADFMTLSRRSNSNYTRLRCFDLYKLHSWAGGLTEFGDGRNQESTSEAVNAYYSAALMGLAYGDTHL
  VAIGSTLTALEIHAAQMWWHVQEGDNQYDQDFVKENKVVGVLWANKRDSGLWFAPPEWRECRLGIQLLPILPISEVLFSNVDFVKELVEWTLPALNREGV
  GEGWKGFVYALQGIYDNEGAMQKIRRLNGFDDGNSLTNLLWW
Full Sequence
Protein Sequence     Length: 738     Download
MLKKLRRKVS TALAGGSRKG SKPYKNTTFK IKTPSPSPSP STPSQLPSPP RRSTMSHTRK    60
HTPFLFPHVD STVVPEPSNF FSSNLVSNPL PTNSFFQNFV LKNGDQPEYI HPYLIKSSNS    120
CLSLSYPSRF MNPSFIYQVF NPDLTISSSQ KSHPSHLNHT ISSHNDLSVT LDIPSSNLRF    180
FLVRGSPFLT LSVTQPTPLS ITTIHAILSF TSSESLTKHT FHLNNGQTWF LYASSPIRLS    240
HGLSEITSDA FSGIIRIALL PGSDWKHEAV LDRFSSCYPV SGEAVFARPF CVEYKWEKRG    300
WGDLLMLAHP LHIQLLADSG SEDVSVLSDF KYGSIDGELV GVVGDSWLLK TDPVSVTWHS    360
VRGVREESRD EVVSALVNDV EGLNSSAIAT NSSYFYGKLV ARAARFALIA EEVCFLDVIP    420
KVRKYLKETI EPWLEGTFNG NGFLYDRKWG GIVTKQGSTD AGADFGFGVY NDHHYHLGYF    480
LYGIAVLAKI DPVWGRKYKP QAYSLMADFM TLSRRSNSNY TRLRCFDLYK LHSWAGGLTE    540
FGDGRNQEST SEAVNAYYSA ALMGLAYGDT HLVAIGSTLT ALEIHAAQMW WHVQEGDNQY    600
DQDFVKENKV VGVLWANKRD SGLWFAPPEW RECRLGIQLL PILPISEVLF SNVDFVKELV    660
EWTLPALNRE GVGEGWKGFV YALQGIYDNE GAMQKIRRLN GFDDGNSLTN LLWWIHSRSD    720
KEEFGHEKIC WFGHYCH*                                                  780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF21.0e-6463719715+
pfam03639Glyco_hydro_81066718702+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69784.10557371685beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.10557211668beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.10557211668beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.1017371744PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305966.10577377690predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916572932405320
FE6916632763536280
FE6916562554847380
ES8165422913456350
ES816542796347120.92
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1Glyma13g07220.1
Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2Glyma13g07210.2.390.614
Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)