y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g22760.1
FamilyCE10
Protein PropertiesLength: 441 Molecular Weight: 48449.2 Isoelectric Point: 8.2065
ChromosomeChromosome/Scaffold: 19 Start: 27890929 End: 27895665
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101234300
  RNSGGDSGGCGGAYRGYAPSPAGNGRRKKLPVVLQFHGGGWVSGSNDSVANDVFCRRVARLCEAVVVAVGYRLAPENRYPAAFEDGLKVLNWLAKQANLA
  ECTKSMGGRRRLEGQHKHIVETFGASVVEPWLAAHGNPSRCVLLGVSCGANIADYVARKAVETGTLLDPVKVVAQVLMYPFFIGSVPTRSEIKLANSYFY
  DKAMCMLAWKLFLPEEEFSLDHPAANPLAPGHGPPLKKMPPTLTVVAEHDWMRDRAIAYSEELRKVNVDAPVYEYKDAVHEFATLDVLLKSPQAQVCAED
  IAIWVKKY
Full Sequence
Protein Sequence     Length: 441     Download
MPSVAVKLYS VFFKFLLKHR LQNRIQGRPE DSDPFGVTTR PDESVAPANP SFSDGVATKD    60
IHIDPLTSLS IRIFLPDSAL EPNSQPSSKP EPGSVNHETS SLRAVRRNSY EPAIFSPREE    120
ERRNSGGDSG GCGGAYRGYA PSPAGNGRRK KLPVVLQFHG GGWVSGSNDS VANDVFCRRV    180
ARLCEAVVVA VGYRLAPENR YPAAFEDGLK VLNWLAKQAN LAECTKSMGG RRRLEGQHKH    240
IVETFGASVV EPWLAAHGNP SRCVLLGVSC GANIADYVAR KAVETGTLLD PVKVVAQVLM    300
YPFFIGSVPT RSEIKLANSY FYDKAMCMLA WKLFLPEEEF SLDHPAANPL APGHGPPLKK    360
MPPTLTVVAE HDWMRDRAIA YSEELRKVNV DAPVYEYKDA VHEFATLDVL LKSPQAQVCA    420
EDIAIWVKKY ISLRGHEFSY *                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00312Esterase_lipase7.0e-5143272139+
pfam00135COesterase9.0e-614219759+
PRK10162PRK101625.0e-713922082+
COG0657Aes3.0e-36139424286+
pfam07859Abhydrolase_35.0e-63155405251+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAS99713.1014401428At3g27320 [Arabidopsis thaliana]
RefSeqNP_001030781.1014401428hydrolase [Arabidopsis thaliana]
RefSeqNP_189367.1014401460hydrolase [Arabidopsis thaliana]
RefSeqXP_002267088.1014401464PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002526925.1014401472conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A1e-32152407113331A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2zsh_A1e-32152407113331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F8e-31152407112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E8e-31152407112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D8e-31152407112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Metabolic Pathways
Pathway NameReactionECProtein Name
formononetin biosynthesisRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
formononetin biosynthesisRXN-3625-2,7-dihydroxy-4'-methoxyisoflavanone dehydratase
isoflavonoid biosynthesis IRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-3303EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-5502-2,7,5-trihydroxy-4'-methoxyisoflavanone dehydratase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7899763561064410
EB4388452791704410
JK5155042671814410
DT4853432771654410
DR9372002711764410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1
Gorai.011G093200.1Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny