y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g22790.1
FamilyCE8
Protein PropertiesLength: 482 Molecular Weight: 53559.5 Isoelectric Point: 5.8585
ChromosomeChromosome/Scaffold: 19 Start: 27982494 End: 27993447
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81684660
  FTVAQDGSGTHKTIIEAIDALAAMDSSRPSRPVIYVKSGVYNEKVDIGINLKNVMFVGDGIDQTIVTGNKNVIQGYSTISSATFDVSGDGFWARDMTFEN
  TAGPSGHQAVALRVSSDLSVFYKCSFKGYQDTLLVHSNRQFYRDCHIYGTIDFIFGDASVVFQNCDIFLRRPMDHQTNFITAQGRDDPNKPTGISIQSCQ
  VKPAYDFDSYKDSIRSYLGRPWKQYSRTLFLKTDLDGLIDPKGWGEWNGDFALSTLYYGEYMNTGSGASTQNRVTWPGFRVLNNDDEATPFSVSQFLQG
Full Sequence
Protein Sequence     Length: 482     Download
MFSCATALLL LLAMATTAYC SSKEMKALKM VQIQVSQARS WVDGYVRLHG LLDKKYVALE    60
DCVKLYGESE SRLSHMLTDM NVYTTHDALT WISSVMTSHK TCLDELKAKG FPEPPQELDK    120
NMTMMLREAL VSYAKNRGKT KEPLQETLLE SNGGLLASWS SGTSNADFTV AQDGSGTHKT    180
IIEAIDALAA MDSSRPSRPV IYVKSGVYNE KVDIGINLKN VMFVGDGIDQ TIVTGNKNVI    240
QGYSTISSAT FDVSGDGFWA RDMTFENTAG PSGHQAVALR VSSDLSVFYK CSFKGYQDTL    300
LVHSNRQFYR DCHIYGTIDF IFGDASVVFQ NCDIFLRRPM DHQTNFITAQ GRDDPNKPTG    360
ISIQSCQVKP AYDFDSYKDS IRSYLGRPWK QYSRTLFLKT DLDGLIDPKG WGEWNGDFAL    420
STLYYGEYMN TGSGASTQNR VTWPGFRVLN NDDEATPFSV SQFLQGEQWI PATGVPFWSG    480
I*                                                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022012.0e-14687481416+
PLN02713PLN027138.0e-15631481502+
PLN02301PLN023013.0e-15923481473+
PLN02916PLN02916023481483+
pfam01095Pectinesterase0167467301+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN75818.1014811485hypothetical protein [Vitis vinifera]
RefSeqNP_191632.20648128519pectinesterase family protein [Arabidopsis thaliana]
Swiss-ProtQ84R100648128519PME36_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 36; Includes: RecName: Full=Pectinesterase inhibitor 36; AltName: Full=Pectin methylesterase inhibitor 36; Includes: RecName: Full=Pectinesterase 36; Short=PE 36; AltName: Full=Pectin methylesterase 36; Short=AtPME36; Flags: Precursor
RefSeqXP_002274478.1064816485PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511680.10144811472Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A01614812319A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A01664813315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B6e-211634363312A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A6e-211634363312A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B7e-211634363312A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH0388452891664540
HO778758455474810
EC9396032851984820
HO777316446544820
FS3411522212524720
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00088.1Aquca_003_00670.1Aquca_012_00135.1Aquca_013_00689.1Aquca_013_00908.1
Aquca_037_00168.1Aquca_020_00600.1Aquca_020_00601.3Aquca_020_00601.1Aquca_003_00668.1
Aquca_010_00267.1Aquca_010_00268.1Aquca_003_00671.1Aquca_013_00908.2Aquca_017_00765.1
Aquca_020_00597.1Aquca_013_00687.1Aquca_013_00688.1Aquca_003_00667.1Aquca_003_00667.2
Aquca_020_00599.1Aquca_020_00596.1Aquca_017_00133.1Aquca_003_00669.1Aquca_013_00581.1
Arabidopsis lyrata478407487284495409490338892433
477852485280880670896648478847
857256864259483936911989471293
905425486545882630481501487283
899938882522871042341207314697
318218483407907399357390864495
882686905963918184876414876418
882513.236.420882513.236.420920857.68.191920857.68.191
Arabidopsis thalianaAT3G10720.2AT5G04970.1AT5G53370.1AT4G02330.1AT3G05620.1
AT1G02810.1AT1G11580.1AT1G53830.1AT2G45220.1AT3G49220.1
AT3G14310.1AT1G23200.1AT3G43270.1AT3G60730.1AT2G26440.1
AT4G33220.1AT5G04960.1AT1G53840.1AT3G14300.1AT3G10710.1
AT2G43050.1AT3G59010.1AT4G02320.1AT2G47550.1AT5G51490.1
AT5G51500.1AT4G02300.1AT1G11590.1AT3G27980.1AT4G03930.1
AT3G10720.1AT4G00190.1AT3G47400.1AT1G11370.1AT1G44980.1
Brachypodium distachyonBradi2g11860.1Bradi2g52140.1Bradi3g37340.1Bradi2g11850.1Bradi1g17940.1
Bradi2g27930.1Bradi2g09090.1
Brassica rapaBra034140Bra009406Bra003062Bra031771Bra036278
Bra022648Bra039419Bra011428Bra030511Bra018000
Bra040563Bra039420Bra027350Bra033348Bra024569
Bra029943Bra019584Bra021403Bra021549Bra021548
Bra020848Bra034553Bra034960Bra007554Bra013692
Bra001547Bra016838Bra005832Bra000540Bra000382
Bra001375Bra004892Bra034139Bra040320Bra037739
Bra004739Bra039694Bra040562Bra001546Bra021547
Bra014550Bra007425Bra004447Bra036280Bra028256
Bra029170Bra028257Bra018152Bra033792Bra005833
Bra000780Bra036279
Carica papayaevm.model.supercontig_1461.3evm.model.supercontig_48.113evm.model.supercontig_145.12evm.model.supercontig_3.310evm.model.supercontig_33.137
evm.model.supercontig_25.194evm.model.supercontig_151.18evm.model.supercontig_344.2evm.model.supercontig_3.77evm.model.supercontig_198.15
evm.model.supercontig_151.19evm.model.supercontig_145.14evm.TU.contig_25723.2evm.model.supercontig_25.193evm.model.supercontig_33.138
evm.model.supercontig_3.309evm.model.supercontig_1540.1
Capsella rubellaCarubv10026136mCarubv10000558mCarubv10008769mCarubv10008673mCarubv10013399m
Carubv10011654mCarubv10016881mCarubv10008680mCarubv10002644mCarubv10013226m
Carubv10013273mCarubv10022923mCarubv10003696mCarubv10024933mCarubv10019247m
Carubv10017009mCarubv10028651mCarubv10022851mCarubv10004474mCarubv10003572m
Carubv10022941mCarubv10013297mCarubv10008670mCarubv10016184mCarubv10015221m
Carubv10023013mCarubv10017004mCarubv10000691mCarubv10027747mCarubv10028350m
Carubv10002406mCarubv10016896mCarubv10015374mCarubv10009760mCarubv10008964m
Carubv10007859m
Citrus clementinaCiclev10000816mCiclev10023723mCiclev10019773mCiclev10014787mCiclev10023718m
Ciclev10019376mCiclev10020108mCiclev10007806mCiclev10003641mCiclev10023535m
Ciclev10024391mCiclev10023588mCiclev10007993mCiclev10000705mCiclev10025238m
Ciclev10004742mCiclev10007942mCiclev10007940mCiclev10014888mCiclev10025232m
Ciclev10003818mCiclev10004719mCiclev10024598m
Citrus sinensisorange1.1g012274morange1.1g015794morange1.1g010441morange1.1g008722morange1.1g043374m
orange1.1g008485morange1.1g008293morange1.1g008261morange1.1g044042morange1.1g011879m
orange1.1g010718morange1.1g008198morange1.1g010103morange1.1g036696morange1.1g007830m
orange1.1g046024morange1.1g036226morange1.1g047288morange1.1g045495morange1.1g027636m
orange1.1g041032m
Cucumis sativusCucsa.181710.1Cucsa.202120.1Cucsa.205350.1Cucsa.359780.1Cucsa.129250.1
Cucsa.149200.1Cucsa.032090.1Cucsa.323330.1Cucsa.257480.1Cucsa.205340.1
Cucsa.282930.1Cucsa.311850.2Cucsa.311850.1Cucsa.045380.1Cucsa.251600.1
Cucsa.280240.1Cucsa.257490.1Cucsa.167050.1Cucsa.078110.1Cucsa.078100.1
Cucsa.149220.1Cucsa.074190.1
Eucalyptus grandisEucgr.E01463.1Eucgr.E01454.1Eucgr.E01468.1Eucgr.E01466.1
Fragaria vescamrna31527.1-v1.0-hybridmrna11074.1-v1.0-hybridmrna21249.1-v1.0-hybridmrna11075.1-v1.0-hybridmrna03929.1-v1.0-hybrid
mrna05465.1-v1.0-hybridmrna10629.1-v1.0-hybridmrna12105.1-v1.0-hybridmrna12871.1-v1.0-hybridmrna12106.1-v1.0-hybrid
mrna12107.1-v1.0-hybridmrna12966.1-v1.0-hybridmrna19567.1-v1.0-hybridmrna12965.1-v1.0-hybridmrna22434.1-v1.0-hybrid
mrna21250.1-v1.0-hybridmrna05463.1-v1.0-hybridmrna21488.1-v1.0-hybridmrna00382.1-v1.0-hybrid
Glycine maxGlyma01g33440.1Glyma19g41950.1Glyma06g47200.1Glyma13g25550.2Glyma03g03410.1
Glyma03g03390.1Glyma01g33500.1Glyma01g33480.1Glyma03g03400.1Glyma10g02160.1
Glyma19g39990.1Glyma03g37391.1Glyma03g03460.1Glyma02g02020.1Glyma10g29150.1
Glyma03g37410.1Glyma19g40010.1Glyma04g41460.1Glyma06g13400.1Glyma19g41960.1
Glyma15g35290.2Glyma07g05145.1.287.582Glyma07g05145.1.287.582Glyma15g20550.1Glyma16g01650.1
Glyma03g37400.1Glyma05g34810.1Glyma09g09050.1Glyma13g17570.2Glyma13g17570.1
Glyma17g04940.1Glyma01g45110.1Glyma02g02000.2Glyma19g40020.1Glyma06g47690.1
Glyma08g04880.3Glyma03g03360.1Glyma05g34800.1Glyma15g20500.1Glyma09g08920.1
Glyma13g17561.1Glyma10g02140.2Glyma13g25560.1Glyma04g13600.1Glyma10g07320.1
Glyma06g47710.1Glyma15g35390.1Glyma06g47190.1Glyma16g01640.1Glyma09g36660.2
Glyma08g04880.4Glyma12g00700.1Glyma09g08960.1Glyma15g20530.2Glyma15g20470.1
Glyma17g04950.2Glyma19g40000.2Glyma17g24815.1Glyma20g38171.1Glyma04g13626.1
Gossypium raimondiiGorai.007G090100.1Gorai.009G147900.1Gorai.011G055100.1Gorai.007G127000.1Gorai.001G140500.1
Gorai.008G143800.1Gorai.007G127100.1Gorai.004G091400.1Gorai.007G302100.1Gorai.008G143700.1
Gorai.010G177500.1Gorai.013G126800.1Gorai.001G018300.6Gorai.001G018300.5Gorai.001G018300.4
Gorai.001G018300.3Gorai.001G018300.2Gorai.001G018300.1Gorai.008G268900.1Gorai.010G094800.2
Gorai.010G094800.1Gorai.009G039100.1Gorai.012G002600.1Gorai.007G015300.1Gorai.010G216700.1
Gorai.009G176700.1Gorai.008G113200.1Gorai.003G114400.1Gorai.005G160000.1Gorai.010G095000.1
Gorai.009G038900.1Gorai.010G173200.1Gorai.009G147800.1Gorai.002G176100.1Gorai.003G114300.1
Gorai.013G221800.1Gorai.004G238700.1Gorai.002G176000.1.171.332Gorai.002G176000.1.171.332
Linum usitatissimumLus10029868Lus10020677Lus10028882Lus10008937Lus10008203
Lus10039314Lus10027202Lus10038917Lus10006103Lus10013344
Lus10018103Lus10017375Lus10022412Lus10010309Lus10010170.606.900
Lus10010170.606.900Lus10027206Lus10003933Lus10029866.235.531Lus10029866.235.531
Lus10031470Lus10015210Lus10009110Lus10015877Lus10037456
Lus10003934.372.635Lus10003934.372.635Lus10033399Lus10034859Lus10026729
Lus10027203Lus10027204Lus10031140Lus10038919Lus10031719
Lus10013416Lus10038918Lus10031720Lus10031141Lus10009287
Lus10010170.124.324Lus10010170.124.324
Malus domesticaMDP0000296741MDP0000734600MDP0000203952MDP0000244964MDP0000231962
MDP0000836165MDP0000196922MDP0000639167MDP0000320566MDP0000798705
MDP0000299884MDP0000267128MDP0000370611MDP0000276688MDP0000288901
MDP0000155267MDP0000183156MDP0000621927MDP0000168682MDP0000244965
MDP0000299506MDP0000229827MDP0000536969MDP0000378862MDP0000146806
MDP0000154985MDP0000250651MDP0000212712
Manihot esculentacassava4.1_005143mcassava4.1_027086mcassava4.1_004724mcassava4.1_023656mcassava4.1_004821m
cassava4.1_004357mcassava4.1_022381mcassava4.1_003930mcassava4.1_004985mcassava4.1_005656m
cassava4.1_007416mcassava4.1_004339mcassava4.1_008249mcassava4.1_028140mcassava4.1_026531m
cassava4.1_026972mcassava4.1_003951mcassava4.1_026771mcassava4.1_004827mcassava4.1_023068m
cassava4.1_006091mcassava4.1_004607mcassava4.1_023616mcassava4.1_005450mcassava4.1_005186m
cassava4.1_033285mcassava4.1_004226mcassava4.1_027994mcassava4.1_031220m
Medicago truncatulaMedtr7g112580.1Medtr1g083520.1Medtr4g124490.1Medtr4g087980.1Medtr8g023310.1
Medtr3g091380.1Medtr1g008140.1Medtr1g088330.1Medtr1g088020.1Medtr1g088220.1
Medtr3g010770.1Medtr7g050980.1Medtr7g050950.1Medtr4g124500.1Medtr4g087970.1
Medtr7g050870.1Medtr2g044880.1Medtr3g033690.1Medtr3g008720.1Medtr3g008640.1
Medtr3g008700.1Medtr4g124520.1Medtr2g044810.1Medtr8g023150.1Medtr3g010780.1
Medtr1g088310.1Medtr1g088040.1
Mimulus guttatusmgv1a025577mmgv1a005211mmgv1a003983mmgv1a003055mmgv1a019770m
mgv1a003278mmgv1a003247mmgv1a003297mmgv1a019879mmgv1a025888m
mgv1a022674mmgv1a003524mmgv1a025514mmgv1a022121mmgv1a022192m
mgv1a020083mmgv1a023297mmgv1a004392mmgv1a004463mmgv1a003215m
mgv1a003670mmgv1a003666mmgv1a022830mmgv1a022827mmgv1a005025m
mgv1a007925mmgv1a026199mmgv1a025432mmgv1a004327mmgv1a004689m
mgv1a004338mmgv1a025735m
Oryza sativaLOC_Os08g34900.1LOC_Os01g21034.1LOC_Os07g47830.1LOC_Os01g57854.1LOC_Os01g20980.1
LOC_Os05g29790.1LOC_Os02g18650.1LOC_Os02g54190.1LOC_Os01g13320.1LOC_Os01g15039.1
LOC_Os06g09340.1LOC_Os11g07090.1
Panicum virgatumPavirv00023339mPavirv00030945mPavirv00038310mPavirv00050878mPavirv00000652m
Pavirv00069475mPavirv00039009mPavirv00069478mPavirv00065907mPavirv00020349m
Pavirv00057614mPavirv00053205mPavirv00065909m
Phaseolus vulgarisPhvul.006G088000.1Phvul.009G053000.1Phvul.010G079900.1Phvul.008G158900.1Phvul.001G209100.1
Phvul.007G246700.1Phvul.001G209200.1Phvul.010G123100.1.300.595Phvul.010G123100.1.300.595Phvul.007G198200.1
Phvul.002G318500.1Phvul.009G222100.1Phvul.005G011900.2Phvul.005G011900.1Phvul.009G261700.1
Phvul.003G126500.1Phvul.001G209300.1Phvul.002G048400.1Phvul.011G188900.1Phvul.006G088100.1
Phvul.002G048700.1Phvul.002G048500.1Phvul.002G048600.1Phvul.007G218500.1Phvul.001G209400.1
Phvul.009G222400.2Phvul.009G222400.1Phvul.010G080300.1Phvul.005G007800.1Phvul.003G126600.1
Phvul.011G005000.1Phvul.005G012000.1Phvul.009G222300.1Phvul.009G222500.1Phvul.011G189000.1
Picea abiesMA_133919g0010MA_10343755g0010MA_9367g0020MA_10372207g0010MA_51464g0010
MA_436039g0010MA_158002g0020MA_150928g0020MA_177306g0010MA_74624g0010
MA_931259g0010MA_101025g0010MA_354248g0010MA_96515g0010MA_177599g0010
MA_84680g0010MA_2017g0010MA_10434031g0010MA_10434624g0020
Populus trichocarpaPotri.005G022700.1Potri.013G013200.1Potri.001G162600.1Potri.001G162500.1Potri.014G067100.1
Potri.002G145500.1Potri.015G127700.1Potri.002G202500.1Potri.012G014500.1Potri.012G126800.1
Potri.018G051400.1Potri.003G072800.1Potri.001G162400.1Potri.014G127000.1Potri.015G127500.1
Potri.011G135000.1Potri.015G013700.1Potri.002G202600.1Potri.005G022800.1Potri.006G134500.1
Potri.003G002800.1Potri.008G011200.1Potri.008G011100.1Potri.003G001900.1Potri.T151500.1
Potri.010G247600.1Potri.003G002600.1Potri.003G002100.1Potri.015G013700.2Potri.010G247700.1
Potri.T148200.1Potri.006G256600.1Potri.006G256700.1Potri.011G025400.1Potri.010G109400.1
Potri.006G134600.1Potri.T148300.1Potri.015G127800.1Potri.006G134800.1Potri.014G149700.1
Potri.T151400.1Potri.003G072700.1Potri.001G162700.1Potri.002G145700.1Potri.012G126900.1
Prunus persicappa004437mppa003474mppa021446mppa003639mppa004300m
ppa003578mppa004413mppa024812mppa003285mppa003047m
ppa003581mppa024156mppa019698mppa003307mppa003697m
ppa003400mppa005208mppa003852mppa003433mppa022308m
ppa004770mppa015202m
Ricinus communis30128.m00886130155.m00162129986.m00164330174.m00884629739.m003669
28166.m00108630147.m01420929842.m00363630128.m00886030155.m001630
29308.m00017530128.m00885929739.m00367529986.m00164429692.m000528
30174.m00884729739.m00367430147.m01420829308.m00017629739.m003677
29684.m00031030024.m001736
Setaria italicaSi029287mSi000942mSi026174mSi019555mSi000786m
Si006114mSi019127m
Selaginella moellendorffii114014
Sorghum bicolorSb03g012830.1Sb02g042780.1Sb07g022090.1Sb03g036790.1Sb03g012820.1
Sb09g017920.1Sb05g006610.1Sb04g035200.1Sb04g011210.1Sb03g000660.1
Sb03g009790.1Sb10g006230.1
Thellungiella halophilaThhalv10020324mThhalv10013020mThhalv10007263mThhalv10013056mThhalv10011343m
Thhalv10020457mThhalv10028546mThhalv10007274mThhalv10007177mThhalv10010220m
Thhalv10029453mThhalv10029374mThhalv10020354mThhalv10001380mThhalv10006472m
Thhalv10002482mThhalv10024907mThhalv10024900mThhalv10011371mThhalv10026774m
Thhalv10013108mThhalv10026924mThhalv10022003mThhalv10001409mThhalv10020407m
Thhalv10011342mThhalv10016522mThhalv10005885mThhalv10013190mThhalv10013189m
Thhalv10010228mThhalv10009515m
Vitis viniferaGSVIVT01037349001GSVIVT01027359001GSVIVT01028040001GSVIVT01014999001GSVIVT01038546001
GSVIVT01031164001GSVIVT01023135001GSVIVT01027356001GSVIVT01027652001GSVIVT01012639001
GSVIVT01027653001GSVIVT01018622001GSVIVT01016667001.363.655GSVIVT01016667001.363.655GSVIVT01031667001
GSVIVT01037348001GSVIVT01018620001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)