y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g24390.1
FamilyCE10
Protein PropertiesLength: 452 Molecular Weight: 49317.3 Isoelectric Point: 8.2781
ChromosomeChromosome/Scaffold: 19 Start: 29964294 End: 29968784
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10824410
  PPEPHSNPRSDPLPRSARADPVSRRSSYGPPLREEHRSSSFGGSSGVEGLNLMSDGVYRGYAPGKRGERRRLPVMLQFHGGGWVSGGSDSVANDAFCRRI
  AKVCDVVVVAVGYRLAPENRYSAAFEDGVKVLNWLAKQANLAECSKSMVGGKSGGHNVGGEFKKSDSHKHIVDSFGASMAEPWLAAHADPSRCVLLGASC
  GANIADYVARKAVEGGKLLDPVKVVAQVLMYPFFIGSVPTRSEIKLANSYFYDKAMCTLAWKLFLPEEEFSLDHPAANPLVPGRGPPLKLMPPTLTVVAE
  HDWMRDRAIAYSEELRKVNVDAPVLEYKDAVHEFATLDVLLKSPQAQVCAEDIAIWAKKY
Full Sequence
Protein Sequence     Length: 452     Download
MPSVAVKLYS VFFKFLLKHR LHNRIQTTSE PSDPFGVTTR PEESVAPANP SFSDGVATKD    60
IHIDPLTSLS IRIFLPESAL TPPEPHSNPR SDPLPRSARA DPVSRRSSYG PPLREEHRSS    120
SFGGSSGVEG LNLMSDGVYR GYAPGKRGER RRLPVMLQFH GGGWVSGGSD SVANDAFCRR    180
IAKVCDVVVV AVGYRLAPEN RYSAAFEDGV KVLNWLAKQA NLAECSKSMV GGKSGGHNVG    240
GEFKKSDSHK HIVDSFGASM AEPWLAAHAD PSRCVLLGAS CGANIADYVA RKAVEGGKLL    300
DPVKVVAQVL MYPFFIGSVP TRSEIKLANS YFYDKAMCTL AWKLFLPEEE FSLDHPAANP    360
LVPGRGPPLK LMPPTLTVVA EHDWMRDRAI AYSEELRKVN VDAPVLEYKD AVHEFATLDV    420
LLKSPQAQVC AEDIAIWAKK YISLRGHEFS Y*                                  480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes8.0e-23139435298+
pfam07859Abhydrolase_37.0e-47175416242+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001030781.1014511428hydrolase [Arabidopsis thaliana]
RefSeqNP_189367.1014511460hydrolase [Arabidopsis thaliana]
RefSeqXP_002267088.1014511464PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002267130.1014511425PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002526925.1014511472conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A4e-31153418113331A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2zsh_A4e-31153418113331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F2e-27153418112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E2e-27153418112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D2e-27153418112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES789976374904520
EB4388452801734520
JK5155042601934520
DR9372002601934520
DT4853432801734520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1
Gorai.011G093200.1Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny