y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g27660.2
FamilyGH38
Protein PropertiesLength: 863 Molecular Weight: 97449 Isoelectric Point: 6.3101
ChromosomeChromosome/Scaffold: 19 Start: 34954619 End: 34966673
DescriptionGlycosyl hydrolase family 38 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38393500
  NVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVLDSVISALLEDKNRKFIYVEMAFFQRWWRQQSKATKIKVKELVNSGQLEFINGGMCMHDEATP
  HYIDLIDQTTLGHQFIKEEFDKVPRVGWQIDPFGHSAVQAYLLGAELGFDSHFFARIDYQDRAKRLKEKTLEVIWQGSRSLGSSSQIFTGIFPRHYDPPD
  GFTFEINDVSPPIQDDILLFDYNVQERVNDFVSAALAQANVTKTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAADEY
  WPLKVDDFFPYA
Full Sequence
Protein Sequence     Length: 863     Download
MMVNAVAVVF AVLVAAIWVA ESEYIEYNTT QRIVPDKLNV HLVPHSHDDV GWLKTVDQYY    60
VGANNSIRGA CVQNVLDSVI SALLEDKNRK FIYVEMAFFQ RWWRQQSKAT KIKVKELVNS    120
GQLEFINGGM CMHDEATPHY IDLIDQTTLG HQFIKEEFDK VPRVGWQIDP FGHSAVQAYL    180
LGAELGFDSH FFARIDYQDR AKRLKEKTLE VIWQGSRSLG SSSQIFTGIF PRHYDPPDGF    240
TFEINDVSPP IQDDILLFDY NVQERVNDFV SAALAQANVT KTNHIMWAMG TDFRYQYANS    300
WFRQMDKFIH YVNQDGRVNA LYSTPSIYTD AKYAADEYWP LKVDDFFPYA DHPNAYWTGY    360
FTSRPALKGY VRFMSAYYQA ARQLEYFKGR NETGPNTDAL ADALAIAQHH DAVSGTERQH    420
VASDYALRLS MGYEEAERLV ASALASLVNQ RLSSYGVNPV TDIQQCPLLN ISYCPPAEAT    480
LINGKSLVIV VYNPLAWKRE DVIRIPVSTG QVFVQDFSGN KIESQILPLS NATLTMRKHY    540
VRAYIGKAPG GDTLKSWLAF PVSVPPLGFS TYIVSSSKQS SHSSTISKIY ISEGSTNKSI    600
EVGKGNLKLL YSENEGRLTH YVNSRTLVTT SVEQSYSYYS GNDGTDKDPQ ASGAYVFRPN    660
GSFSIKSDHQ ASFTVLRGPI LDEVHQQLNP WVSQITRIFK AKEHAEIEFT VGPIPVDDDI    720
GKEIITQFKT TMKTNKTFYT DSNGRDFIKR IRDFRTDWDL QVNQPIAGNY YPVNLGIYVQ    780
DSSMELSVLV DRSVGGSSLE DGQVELMLHR RLLHDDARGV GEVLNETVCV ADKCEGLTVK    840
YIFPTNPFRL AFMMISGYVF HL*                                            900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10809GH38N_AMII_GMII_SfManIII_like5.0e-7337361358+
pfam01074Glyco_hydro_381.0e-9739350316+
PLN02701PLN027015.0e-10736822885+
cd00451GH38N_AMII_euk2.0e-10938313276+
cd10810GH38N_AMII_LAM_like038314279+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21275.1058402836unnamed protein product [Vitis vinifera]
RefSeqNP_189306.1018431838glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
RefSeqXP_002276199.1058402835PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301760.101384315845predicted protein [Populus trichocarpa]
RefSeqXP_002512839.101084810849lysosomal alpha-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7d_A0273203298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1hxk_A02582238850A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A02582238850A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A02582238850A Chain A, Golgi Alpha-Mannosidase Ii
PDB3eju_A02582268880A Chain A, Golgi Alpha-Mannosidase Ii
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7800625213318480
HO780062872463320
FG2273944941876790
DW492273301623620
HO780062244104330.37
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)