y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g29730.1
FamilyGT47
Protein PropertiesLength: 521 Molecular Weight: 59589.8 Isoelectric Point: 8.8435
ChromosomeChromosome/Scaffold: 19 Start: 37457990 End: 37461737
Descriptionexostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT471234440
  AVLRVFMYDLPPEFHFGLLDWKPEENVNNVWPDIKTKAPHYPGGLNLQHSIEYWLTLDLLASELPESEAPSNARSVIRVRNSSEADVIFVPFFSSLCYNR
  LSKTGPHEKRSRNKLLQEKLVKYVTAQEEWKRSGGKDHVILAHHPNSMLDARMKLWPGTFILSDFGRYPTNIANVEKDVIAPYKHVVGSYDNDQSSFDSR
  TTLLYFQGAIYRKDGGHVRHELYYLLKNEKDVHFSFGSVQKGGVRKATEGMRSSKFCLNIAGDTPSSNRLFDAIASHCVPVIISDDIELPYEDVLDYSQF
  CIFVRTRDALKKRYLINFIRSI
Full Sequence
Protein Sequence     Length: 521     Download
MVERTVSGSA IKVVSKKSLC GFFTMTTLLF MLSWLFVLRS TRSEASPNSN LFSSYSNSDF    60
DHSVQQQKNV EEEVEPSFGN RAILVDNIEA AAAATTTTTT TTHDDKQQVL EEQGVKCKAH    120
DKAVLRVFMY DLPPEFHFGL LDWKPEENVN NVWPDIKTKA PHYPGGLNLQ HSIEYWLTLD    180
LLASELPESE APSNARSVIR VRNSSEADVI FVPFFSSLCY NRLSKTGPHE KRSRNKLLQE    240
KLVKYVTAQE EWKRSGGKDH VILAHHPNSM LDARMKLWPG TFILSDFGRY PTNIANVEKD    300
VIAPYKHVVG SYDNDQSSFD SRTTLLYFQG AIYRKDGGHV RHELYYLLKN EKDVHFSFGS    360
VQKGGVRKAT EGMRSSKFCL NIAGDTPSSN RLFDAIASHC VPVIISDDIE LPYEDVLDYS    420
QFCIFVRTRD ALKKRYLINF IRSIGKEEWT RMWNRLKEVE SFFEFQFPSK EGDAVQMIWK    480
AIARKVPFMK LKTNRSRRFL RSLYGNDMGN KSITTPANFW *                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin3.0e-55125444330+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX33321.1075206509secondary cell wall-related glycosyltransferase family 47 [Populus tremula x Populus tremuloides]
RefSeqXP_002268382.107652042488PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319201.1074998449predicted protein [Populus trichocarpa]
RefSeqXP_002325457.1012252070463predicted protein [Populus trichocarpa]
RefSeqXP_002530948.107651765497catalytic, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1938
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG5918492482595060
EH7638542672355010
BM4080072371974330
FG6075792991994950
EV5666512512054550
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00053.1Aquca_013_00618.5Aquca_030_00332.1Aquca_009_00090.1Aquca_042_00116.2
Aquca_042_00116.1Aquca_023_00060.1Aquca_002_00598.3Aquca_002_00598.2Aquca_002_00598.1
Aquca_013_00618.4Aquca_013_00618.3Aquca_013_00618.2Aquca_013_00618.1
Arabidopsis lyrata482474313939494490338977476604
477609484930909677
Arabidopsis thalianaAT2G35100.1AT5G44930.2AT5G44930.1AT1G67410.1AT3G03650.1
AT1G74680.1AT3G45400.1AT1G34270.1AT5G16890.1
Brachypodium distachyonBradi2g53000.1Bradi1g63740.1Bradi1g24360.1Bradi2g59047.1Bradi4g26150.1
Bradi3g37030.1Bradi5g25660.1
Brassica rapaBra005369Bra023001Bra034000Bra036746Bra004088
Bra031981Bra038288Bra003790Bra023587Bra006378
Bra028047Bra008584
Carica papayaevm.model.supercontig_30.157evm.model.supercontig_43.42evm.model.supercontig_73.11evm.model.supercontig_43.87evm.model.supercontig_111.8
evm.model.supercontig_66.112
Capsella rubellaCarubv10025262mCarubv10026328mCarubv10009012mCarubv10020184mCarubv10016173m
Carubv10017118mCarubv10020282mCarubv10002876mCarubv10015810m
Citrus clementinaCiclev10031603mCiclev10031600mCiclev10015089mCiclev10031340mCiclev10019794m
Ciclev10019803mCiclev10000997mCiclev10019875m
Citrus sinensisorange1.1g014095morange1.1g014048morange1.1g011685morange1.1g011195morange1.1g010594m
orange1.1g011757morange1.1g011167morange1.1g011152m
Cucumis sativusCucsa.056260.1Cucsa.236080.1Cucsa.332740.1Cucsa.090160.1Cucsa.112780.1
Eucalyptus grandisEucgr.B03487.1Eucgr.E04252.1Eucgr.A02153.1Eucgr.K00083.1Eucgr.F02636.1
Eucgr.B00504.1Eucgr.F01298.1
Fragaria vescamrna20016.1-v1.0-hybridmrna12575.1-v1.0-hybridmrna27505.1-v1.0-hybridmrna06060.1-v1.0-hybridmrna26011.1-v1.0-hybrid
Glycine maxGlyma07g34570.1Glyma20g02340.1Glyma03g00910.1Glyma01g07060.1Glyma17g10840.1
Glyma06g20840.2Glyma08g10920.1Glyma04g33600.2Glyma05g27950.1Glyma11g11550.1
Glyma12g02010.3Glyma12g02010.1Glyma20g31360.1Glyma02g12920.2Glyma10g36230.1
Glyma05g01051.1Glyma04g33600.1
Gossypium raimondiiGorai.003G052700.2Gorai.009G332700.2Gorai.009G332700.1Gorai.005G267400.2Gorai.005G267400.1
Gorai.002G184100.2Gorai.005G168600.1Gorai.002G184100.1Gorai.013G196700.1Gorai.004G257200.1
Gorai.007G252800.1Gorai.003G052700.1Gorai.004G113300.1Gorai.005G075900.2Gorai.005G075900.1
Gorai.011G272600.1Gorai.002G184100.3Gorai.002G184100.4
Linum usitatissimumLus10036219Lus10038355Lus10039145Lus10013787Lus10033734
Lus10003870Lus10037016Lus10015791Lus10020308Lus10005684
Lus10002060Lus10031610Lus10013627Lus10024214
Malus domesticaMDP0000223942MDP0000195867MDP0000199026MDP0000175549MDP0000558976
MDP0000482184MDP0000419029MDP0000282146MDP0000266169MDP0000245563
MDP0000693745MDP0000279572MDP0000162640MDP0000200985MDP0000241559
MDP0000206538
Manihot esculentacassava4.1_023143mcassava4.1_006493mcassava4.1_007991mcassava4.1_022793mcassava4.1_032917m
cassava4.1_005963mcassava4.1_006429mcassava4.1_006323mcassava4.1_006525m
Medicago truncatulaMedtr4g078020.1Medtr4g077920.1Medtr3g085480.1Medtr4g084200.1Medtr7g087100.1
Medtr7g087120.1
Mimulus guttatusmgv1a009897mmgv1a010020mmgv1a005660mmgv1a022533mmgv1a004804m
mgv1a005938mmgv1a020908mmgv1a005291mmgv1a019485mmgv1a005764m
Oryza sativaLOC_Os01g59630.1LOC_Os04g57510.1LOC_Os07g37960.1LOC_Os01g69220.1LOC_Os12g03100.1
LOC_Os11g03410.1LOC_Os08g34020.2LOC_Os08g34020.1LOC_Os03g20850.1LOC_Os04g57510.2
Panicum virgatumPavirv00056704mPavirv00014489mPavirv00064353mPavirv00049701mPavirv00020813m
Pavirv00002856mPavirv00019260mPavirv00022063mPavirv00039830mPavirv00041807m
Pavirv00048056mPavirv00007724mPavirv00054522m
Physcomitrella patensPp1s307_10V6.2Pp1s307_10V6.1Pp1s237_53V6.1Pp1s169_88V6.1Pp1s45_211V6.1
Pp1s39_178V6.1Pp1s15_277V6.1Pp1s48_110V6.1Pp1s326_70V6.1Pp1s30_180V6.1
Pp1s106_65V6.1Pp1s34_108V6.1Pp1s34_108V6.2
Phaseolus vulgarisPhvul.002G097200.1Phvul.001G107400.1Phvul.003G190200.1Phvul.004G074100.1Phvul.002G174100.1
Phvul.009G187300.1Phvul.011G019900.1Phvul.007G087100.1
Picea abiesMA_10428894g0010MA_10427831g0010MA_104022g0010MA_168957g0010MA_10429747g0010
MA_10429909g0020MA_362407g0010MA_7513659g0010
Populus trichocarpaPotri.019G049800.3Potri.015G124800.2Potri.015G124800.1Potri.008G034500.1Potri.013G116200.1
Potri.012G124600.1Potri.013G067400.2Potri.013G067400.1Potri.019G044600.2Potri.019G044600.1
Potri.002G210000.1Potri.019G049800.2Potri.019G049800.1Potri.T071700.3Potri.T071700.2
Potri.T071700.1Potri.019G086800.1Potri.005G055000.1Potri.012G135800.1
Prunus persicappa005538mppa004914mppa004491mppa005995mppa004625m
ppa004627m
Ricinus communis29840.m00061530128.m00872829818.m00039330138.m00407929717.m000231
30073.m002257
Setaria italicaSi025194mSi001454mSi029615mSi015706mSi001155m
Si026308mSi010016mSi035588mSi002120m
Selaginella moellendorffii147086857471076759836299588
418827.96.275418827.96.275418827.290.358418827.290.358
Sorghum bicolorSb01g036720.1Sb02g036640.1Sb03g044100.1Sb08g001860.2Sb08g001860.1
Sb03g037670.1Sb07g021480.1Sb06g032380.1
Thellungiella halophilaThhalv10016654mThhalv10000882mThhalv10007515mThhalv10018590mThhalv10018515m
Thhalv10020580mThhalv10002514mThhalv10020554mThhalv10013266m
Vitis viniferaGSVIVT01012106001GSVIVT01014123001GSVIVT01008002001GSVIVT01029936001GSVIVT01036850001
GSVIVT01010454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)