y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g30150.1
FamilyGH51
Protein PropertiesLength: 643 Molecular Weight: 70992.9 Isoelectric Point: 5.6504
ChromosomeChromosome/Scaffold: 19 Start: 37816140 End: 37819855
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511976390
  TNRNASLQITTSNRGVVWLDQVSAMPLDTFKGHGYRKDLFQMVADLKPNFFRFPGGCYVEGNYLRNAFRWKDTVGPWEERPGHFNDVWNYWTDDGFGFFE
  GLQFAEDVGALPTWVFNNGLSLNDEVNTSAIAPFIQEALDGIEFARGSPKSQWGSLRASMGHPEPFDLRIVAIGNEECGMPKYQANYLKFHAAIKQAYPD
  IQIITNCDGSKKPLDHPADLYDFHIYTNATDMFSKSTKFDDAPRSGPKAFVSEYAVWKDDAGNGTLLAAVAEAAFLIGLERNSDVVHMVSYAPLFVNTND
  RKWTPDAIVFDSHQHYGTPSYWVQHLFTTSSGATLLNTTLQTSTDSLVASAIEYTNPKDKKNYLRIKVVNFGSDQQNLRFSISGLTSNVQQSGAAKTVLT
  GPNVKEENSFSEPNKIAPQHSSLEDASGDMNVVLAPYSVTSFD
Full Sequence
Protein Sequence     Length: 643     Download
MSLPIKICLL YLTCLTVSCF AEQTSTLIVD AKGSVRKIPD TFFGAFFEEI NHAGAGGLWA    60
ELVRNRGFEA GGPNVPSNIF PWSIIGDDST ILVSTDRTSC FERNKVALRM NILCNESNPC    120
PAGGVGISNP GFWGMNIEKG QKYKVVFYVK ARGRLDLDVS FVGSVSGAKL ASQNFRAPGQ    180
NISMWTRMET ILEANDTNRN ASLQITTSNR GVVWLDQVSA MPLDTFKGHG YRKDLFQMVA    240
DLKPNFFRFP GGCYVEGNYL RNAFRWKDTV GPWEERPGHF NDVWNYWTDD GFGFFEGLQF    300
AEDVGALPTW VFNNGLSLND EVNTSAIAPF IQEALDGIEF ARGSPKSQWG SLRASMGHPE    360
PFDLRIVAIG NEECGMPKYQ ANYLKFHAAI KQAYPDIQII TNCDGSKKPL DHPADLYDFH    420
IYTNATDMFS KSTKFDDAPR SGPKAFVSEY AVWKDDAGNG TLLAAVAEAA FLIGLERNSD    480
VVHMVSYAPL FVNTNDRKWT PDAIVFDSHQ HYGTPSYWVQ HLFTTSSGAT LLNTTLQTST    540
DSLVASAIEY TNPKDKKNYL RIKVVNFGSD QQNLRFSISG LTSNVQQSGA AKTVLTGPNV    600
KEENSFSEPN KIAPQHSSLE DASGDMNVVL APYSVTSFDL LK*                      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA2.0e-37230635480+
pfam06964Alpha-L-AF_C3.0e-45448634205+
smart00813Alpha-L-AF_C3.0e-54448634198+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.10864118655alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABV08815.101964116645alpha-L-arabinofuranosidase [Fragaria x ananassa]
DDBJBAF42035.1046417655alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002307940.10564117651predicted protein [Populus trichocarpa]
RefSeqXP_002523672.101464129659Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L3e-2423061248454A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K3e-2423061248454A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J3e-2423061248454A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I3e-2423061248454A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H3e-2423061248454A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8526834132306400
HO7807403862596420
GT0462043492155630
HO8072913161374520
GE4801223052425450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma03g00626.1
Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2Glyma19g30145.1
Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)