y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g30460.1
FamilyGH51
Protein PropertiesLength: 647 Molecular Weight: 72067.2 Isoelectric Point: 4.9385
ChromosomeChromosome/Scaffold: 19 Start: 38067217 End: 38073754
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511706410
  DVIKVASSRRHVYGDGKWKRVETIVEAKTTNHYSSLQITTTREGSYLLDQVSVMPLDTYMGHGFRNDLFQMVADLKPKFLRFPGGCYVEGNYLRNRFQWK
  DTIGPWEERPGHLGDVWNYWSDDGIGFFEYLLLAEDLGALPIWVFNAGFGLNDEIDTSSIESYVQDALDGIEFARGSPTSQWGSVRAAMGHPTPFDLRYV
  AVGNENCWQTYFNYQGNYLKFYEAIKAAYPDIQIISNCDASRKPLNHPADLFDFHTYPSSNDMFSLFTKFDNTSRSGPKAFVSEYAVKSDAANGNLLAAV
  AEAAFLIGLEKNSDIVEMVSYAPLFLNINDKRWIPDAIVFDSYQVYGTPSYWVQKLFIESSGATFIDSTLSTTSSNKLAASVIIWQDSSDKKNYLRIKAV
  NFGAAAESLDIDLSGLDSNVQQYGSTITVLTSTNVMDENSFLEPKKVVPQTSPLEIDDKHLIVLLPSYSVIS
Full Sequence
Protein Sequence     Length: 647     Download
MAYCSLKVLF GVVLYAFAFQ HCYADANSTL IVNAASNNAT ARQIPNTFLG VFVEEINHAG    60
AGGLWAELVI NRGFEAGGPN NALNVYNWSI IGDESSISVS ISRTSCFERN KAALQMEVYC    120
GAHKPCPYGV GISNPGYWGM NIEQGKRYKV VYHVKSERKF DFQLSFTGVD VIKVASSRRH    180
VYGDGKWKRV ETIVEAKTTN HYSSLQITTT REGSYLLDQV SVMPLDTYMG HGFRNDLFQM    240
VADLKPKFLR FPGGCYVEGN YLRNRFQWKD TIGPWEERPG HLGDVWNYWS DDGIGFFEYL    300
LLAEDLGALP IWVFNAGFGL NDEIDTSSIE SYVQDALDGI EFARGSPTSQ WGSVRAAMGH    360
PTPFDLRYVA VGNENCWQTY FNYQGNYLKF YEAIKAAYPD IQIISNCDAS RKPLNHPADL    420
FDFHTYPSSN DMFSLFTKFD NTSRSGPKAF VSEYAVKSDA ANGNLLAAVA EAAFLIGLEK    480
NSDIVEMVSY APLFLNINDK RWIPDAIVFD SYQVYGTPSY WVQKLFIESS GATFIDSTLS    540
TTSSNKLAAS VIIWQDSSDK KNYLRIKAVN FGAAAESLDI DLSGLDSNVQ QYGSTITVLT    600
STNVMDENSF LEPKKVVPQT SPLEIDDKHL IVLLPSYSVI SLDFLI*                  660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA1.0e-32232643482+
pfam06964Alpha-L-AF_C1.0e-41452638205+
smart00813Alpha-L-AF_C1.0e-47452638198+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK50089.1016451656AF372949_1 AT3g10740/T7M13_18 [Arabidopsis thaliana]
GenBankABV08815.102264616646alpha-L-arabinofuranosidase [Fragaria x ananassa]
RefSeqNP_187685.1016451656ASD1 (ALPHA-L-ARABINOFURANOSIDASE 1); alpha-N-arabinofuranosidase/ hydrolase, acting on glycosyl bonds / xylan 1,4-beta-xylosidase [Arabidopsis thaliana]
RefSeqXP_002307940.1026456651predicted protein [Populus trichocarpa]
RefSeqXP_002523672.102464536659Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vrk_C3e-2023264451493A Chain A, Structure Of A Seleno-Methionyl Derivative Of Wild Type Arabinofuranosidase From Thermobacillus Xylanilyticus
PDB2vrk_B3e-2023264451493A Chain A, Structure Of A Seleno-Methionyl Derivative Of Wild Type Arabinofuranosidase From Thermobacillus Xylanilyticus
PDB2vrk_A3e-2023264451493A Chain A, Structure Of A Seleno-Methionyl Derivative Of Wild Type Arabinofuranosidase From Thermobacillus Xylanilyticus
PDB4atw_F5e-2023164347482A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_E5e-2023164347482A Chain A, The Crystal Structure Of Arabinofuranosidase
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8526834182326460
HO7807403872616450
GT0462043522175670
GT0486153482776230
GE4801223072445490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma03g27490.1Glyma19g30470.2Glyma19g30145.1
Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)