y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g30580.1
FamilyCBM20
Protein PropertiesLength: 966 Molecular Weight: 111416 Isoelectric Point: 5.698
ChromosomeChromosome/Scaffold: 19 Start: 38197785 End: 38210680
Descriptiondisproportionating enzyme 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20161027.1e-23
  VKVSFRIPYFTQWGQSLLVCGSVPVLGSWNVKKGVLLSPVHQGAELIWGGSITVPKGFQCQYSYYVVDDNKNVLRWEMGKKRELVLR
GH772729200
  VPMFSVRSESDLGVGEFLDLKLLVDWAVASGFHLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSKNIPEEIKKEIEKAKQQLDGKDVDYE
  ATMATKLSIAKKVFAQEKDLILNSSSFKEFFSENEGWLKPYAAFCFLRDFFETSDRTQWGCFAHYSEDKLEKLVSKDSLHYEIICFHYYVQYHLHLQLSE
  AAEYARKKGVILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNYGWWRARLTQMAKYFTAYRIDHILGFFRIWEL
  PDHAATGLVGKFRPSIPLSQEELEREGIWDFNRLSYPYIKRELLQEKFGDAWTFVATTFLKEIDKNFYEFKEDCNTEKKIASKLKTCAESSLLLESVDKL
  QRNLFDLSQNIVLIRDPEDPRKFYPRFNLEDTISFQDLDDHSKNVLKRLYHDYYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQEL
  GLVGLRIQRMPNEPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDGLPPDQCVPEVAHFVIRQHFEAPSMWAIFPLQDLLALK
  EEYTTRPATEETINDPTNPKHYWRFRVHVTLESLIKDNDLQTTIKDLVS
Full Sequence
Protein Sequence     Length: 966     Download
MVNPGLFSAN KSTNSVKVSF RIPYFTQWGQ SLLVCGSVPV LGSWNVKKGV LLSPVHQGAE    60
LIWGGSITVP KGFQCQYSYY VVDDNKNVLR WEMGKKRELV LREGIQSGQE IEFRDLWQTG    120
SDALPFRSAF KDVIFRQSWD LSDATVGVNH INVEPEGEAI LVQFKISCPN IEKDTSIYVI    180
GSNTKLGQWK VENGLKLSYF GESVWKAECV MQRSDFPIKY RYGKYDRSGN FSIESGPNRE    240
VYANSPRNEA KYIFLSDGMM REIPWRGAGV AVPMFSVRSE SDLGVGEFLD LKLLVDWAVA    300
SGFHLVQLLP INDTSVHGMW WDSYPYSSLS VFALHPLYLR VQALSKNIPE EIKKEIEKAK    360
QQLDGKDVDY EATMATKLSI AKKVFAQEKD LILNSSSFKE FFSENEGWLK PYAAFCFLRD    420
FFETSDRTQW GCFAHYSEDK LEKLVSKDSL HYEIICFHYY VQYHLHLQLS EAAEYARKKG    480
VILKGDLPIG VDRNSVDTWV YPNLFRMNTS TGAPPDYFDK NGQNWGFPTY NWEEMSKDNY    540
GWWRARLTQM AKYFTAYRID HILGFFRIWE LPDHAATGLV GKFRPSIPLS QEELEREGIW    600
DFNRLSYPYI KRELLQEKFG DAWTFVATTF LKEIDKNFYE FKEDCNTEKK IASKLKTCAE    660
SSLLLESVDK LQRNLFDLSQ NIVLIRDPED PRKFYPRFNL EDTISFQDLD DHSKNVLKRL    720
YHDYYFCRQE NLWRQNALKT LPVLLNSSDM LACGEDLGLI PSCVHPVMQE LGLVGLRIQR    780
MPNEPDLEFG IPSKYSYMTV CAPSCHDCST LRAWWEEDEE RRLRFFKNVM ESDGLPPDQC    840
VPEVAHFVIR QHFEAPSMWA IFPLQDLLAL KEEYTTRPAT EETINDPTNP KHYWRFRVHV    900
TLESLIKDND LQTTIKDLVS WSGRSLPKED DSEIEASPVS VLSAAEALSE KQKFASTTEK    960
PVLVK*                                                               1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02446Glyco_hydro_774.0e-46743920179+
COG1640MalQ2.0e-68269573307+
pfam02446Glyco_hydro_779.0e-110272582313+
PLN02950PLN0295008915912+
PLN03236PLN032360265925687+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAR99599.10195519444-alpha-glucanotransferase [Solanum tuberosum]
EMBLCBI32836.1019601949unnamed protein product [Vitis vinifera]
RefSeqXP_002278329.1019601949PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308854.1019331948predicted protein [Populus trichocarpa]
RefSeqXP_002323208.1019426907predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1tz7_B3e-2726658322329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A3e-2726658322329A Chain A, Aquifex Aeolicus Amylomaltase
PDB2x1i_A2e-2630158339316A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
PDB2x1i_A0.005735898329477A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
PDB1esw_A9e-2630158339316A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1828EC-2.4.1.254-α-glucanotransferase
starch degradation IIRXN-12391EC-2.4.1.254-α-glucanotransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7946055694079660
HO7946052811133930
HO7797145081246310
HO4763014314688930
HO77971431961260.49
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)