y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g31820.2
FamilyGT1
Protein PropertiesLength: 391 Molecular Weight: 44140.4 Isoelectric Point: 7.0304
ChromosomeChromosome/Scaffold: 19 Start: 39602584 End: 39605253
DescriptionUDP-glycosyltransferase 73B4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1693692.2e-34
  PNCESYTFHSVSAFTMFLYFWDAMGRPPVEKVSHVIPEVPSLEGCFTTRCIDFITSQYEFHKFSKGTIYNTTRVIESPYLELIKRIISSKTHWALGPFNP
  LSIEKGVYNTKHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKFIWVVRDADKGDVFIEDGVRTSELPKGFEERVKGTGLVVRDWAPQ
  LEILSHSSTGGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNRVLVTEVLKIGVVVKDWDHRDELVTASDVENAVRRLIATKEGDEMRQRAMNLKNAIR
  R
Full Sequence
Protein Sequence     Length: 391     Download
MASNYRSHNK KSHDNDMFHP TQVVVVVAST SLRVPVYALL QSLSSVARRV VVIYDSLMAS    60
VVQDAIHVPN CESYTFHSVS AFTMFLYFWD AMGRPPVEKV SHVIPEVPSL EGCFTTRCID    120
FITSQYEFHK FSKGTIYNTT RVIESPYLEL IKRIISSKTH WALGPFNPLS IEKGVYNTKH    180
FSVEWLDKQE AGSVLYVSFG TTTCFSEEQI KEVANGLEKS KQKFIWVVRD ADKGDVFIED    240
GVRTSELPKG FEERVKGTGL VVRDWAPQLE ILSHSSTGGF MSHCGWNSCM ESITMGVPIA    300
AWPMHSDQPR NRVLVTEVLK IGVVVKDWDH RDELVTASDV ENAVRRLIAT KEGDEMRQRA    360
MNLKNAIRRS RDEGGVSRVE LDDFIAHITR *                                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02448PLN024489.0e-5129389396+
PLN02992PLN029926.0e-51165381228+
PLN02863PLN028632.0e-53120390286+
PLN00164PLN001645.0e-54133381257+
PLN03007PLN030075.0e-6276389342+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM09513.2028390101461AF489873_1 putative glucosyltransferase [Glycine max]
GenBankAAM09514.2028390102464AF489874_1 zeatin O-glucosyltransferase [Glycine max]
GenBankAAM09516.1028390101462AF489876_1 putative glucosyltransferase [Phaseolus lunatus]
GenBankAAM09517.102039093462AF489877_1 putative glucosyltransferase [Phaseolus lunatus]
Swiss-ProtQ9ZSK502839098459ZOG_PHALU RecName: Full=Zeatin O-glucosyltransferase; AltName: Full=Trans-zeatin O-beta-D-glucosyltransferase
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A2.00386e-43110377171456A Chain A, Pectin Methylesterase From Carrot
PDB2vch_A2.00386e-43110377171456A Chain A, Pectin Methylesterase From Carrot
PDB2vce_A2.00386e-43110377171456A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbj_A7e-37150389230453A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbf_A7e-37150389230453A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783565316793910
EG631252370283910
HO8016862431523910
BE2112481941673600
FE7065302671253910
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)