y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g33620.2
FamilyGH13
Protein PropertiesLength: 866 Molecular Weight: 96473.9 Isoelectric Point: 6.6434
ChromosomeChromosome/Scaffold: 19 Start: 41194146 End: 41196743
Descriptiondebranching enzyme 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133786962e-25
  AGTFTGLAKKVQHFKDLGVNAVLLEPVFTFDEKKGPYFPCHFFSLMHIYGPSGGPVSAIAAMKEMVKTMHANGIEVLVEVVFSNTAEIGAIQGIDDSSYY
  YANGVGGLKVQSALNCNYPIVQNLILDSLRHWVTEFHIDGFSFINASHLLRGFHGEYLSRPPLVEAIAFDPVLSKTKIIADCWDPHGMVAKEIRFPHWMR
  WAEMNTHFCNDVRNFLRGQNLLSDLATRLCGSGDIFSGGRGPGFSFNYIARNFGVSLVDLVSFSSVDELSWNCGAEGPTNNTAVLERRLKQIRNFLFILF
  VSLGVPVLNMGDECGQSSG
Full Sequence
Protein Sequence     Length: 866     Download
MAILAPRFSF SVIPRNHHKL KRSFSHKPFI QRKQLWHQLG LQSLVSPFSL NPTSSKLCAT    60
SRLSIEETEQ QIGTLTRPED LKGSLAYLFR TETGGGLVKV HVTRRNDRYS VYIEISSLDI    120
SGGVGEALLL CWGVYRSDSS CFVDLDTIGL SENAAMGMNV SPLVQNSDGK FAIELEFDAK    180
HVPLYLSFFL MSSLDSGLEI RSHRRTNFCM PVGSLPGYPC PLGVSYSPDG SVNFSIFSRH    240
AESVVLCLYD ENGVEKPALE LDLDPYVNRT GDIWHVSFES AKGFVSYGYR CRRGVLKKNK    300
DDGFAEHVVL DPYAKIVGNS YPDGVGLVKN LGCLRKEPFF DWGGDRHPDL SMEKLVVYRL    360
NVKRFTQHES SQLPSGLAGT FTGLAKKVQH FKDLGVNAVL LEPVFTFDEK KGPYFPCHFF    420
SLMHIYGPSG GPVSAIAAMK EMVKTMHANG IEVLVEVVFS NTAEIGAIQG IDDSSYYYAN    480
GVGGLKVQSA LNCNYPIVQN LILDSLRHWV TEFHIDGFSF INASHLLRGF HGEYLSRPPL    540
VEAIAFDPVL SKTKIIADCW DPHGMVAKEI RFPHWMRWAE MNTHFCNDVR NFLRGQNLLS    600
DLATRLCGSG DIFSGGRGPG FSFNYIARNF GVSLVDLVSF SSVDELSWNC GAEGPTNNTA    660
VLERRLKQIR NFLFILFVSL GVPVLNMGDE CGQSSGGFTA YDGIKPFSWS ALKTGFGKQT    720
SEFIFFLSSL RKRRSYLLQR RSFLKEENIE WYGSDGDPPR WEDPSCKFLA MILKAEVTEF    780
LESSVSSDIS GDLFIAFNAT DHPETAVLPL PPEGMSWYRL VDTALPFPGF FSTSGEVVPE    840
QTEGLFTYQV KSYSCTLFEA NNRTI*                                         900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK03705PRK037052.0e-70215809661+
TIGR02100glgX_debranch1.0e-99216828704+
cd11326AmyAc_Glg_debranch2.0e-109340697407+
COG1523PulA5.0e-110216852714+
cd11346AmyAc_plant_IsoA3.0e-133351724387+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN15318.105686169857isoamylase isoform 2 [Solanum tuberosum]
GenBankAAZ81836.1018611853isoamylase isoform 2 [Pisum sativum]
DDBJBAF52942.1018651865isoamylase-type starch-debranching enzyme 2 [Phaseolus vulgaris]
RefSeqXP_002271798.105686170878PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002533079.102686040867isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B021681114675A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB2vuy_A021681114675A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB2vr5_B021681114675A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB2vr5_A021681114675A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB2vnc_B021681114675A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8176183333536820
ES8319262903426300
DR9266472973626510
ES7598062462745190
GE6350582724467140
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)