y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g34960.1
FamilyAA3
Protein PropertiesLength: 745 Molecular Weight: 82227.9 Isoelectric Point: 7.9001
ChromosomeChromosome/Scaffold: 19 Start: 42557789 End: 42561603
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32157410
  EKGLEVTEDKRQNLYKVKCDVVIVGSGCGGGVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAVNWS
  ASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQGCEKMGLKVESVAINSSADHYCGSCCYGCRTGDKKGTDSTWLVD
  SVGNGAVILTGCKAERFILENGKNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTT
  NFSGNNYEGGIITSIHKEYAEDSTPRFIIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLDKEDKESLRVGLRK
  ALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAV
  GVNPMVTIQSTSYCIASKIAESLGKAS
Full Sequence
Protein Sequence     Length: 745     Download
MEGRESCHPL LRGGRRREEK GYNHGLSTTQ MHVMAAICDA LIPSLPLNKD TSQDQALSDF    60
YNTSASQLPF PDEAAELLYK RTVPEAVSLV SWVLWILSFR LGTLLLCGRL SLDWKWPFIR    120
KFSEISLEKR EQIFRNWTRE KSWVALRVVF VLIKLFCFYN FFSRTDANGQ NPTWKAIGYQ    180
VDTKEKLIRK ERPLEKGLIE TMYETDSTLI QSLTEKGLEV TEDKRQNLYK VKCDVVIVGS    240
GCGGGVAAAV LANSGHKVVV LEKGEYFVSH DYSSLEGPSM DEQYESGGIM PSLDGKMMIL    300
AGSTVGGGSA VNWSASIRTP DSVLREWSKK YKIPLFGSSD YQSAMDSVCR RIGVTEKCKK    360
ESFQNQILIQ GCEKMGLKVE SVAINSSADH YCGSCCYGCR TGDKKGTDST WLVDSVGNGA    420
VILTGCKAER FILENGKNGM KKKKCLGVIA AASWRSKVTK KLQIESKVTI SACGSLNTPP    480
LMISSGLKNP NIGRNLHLHP VQFAWGYFPE DMTTNFSGNN YEGGIITSIH KEYAEDSTPR    540
FIIETPSLGP GSFSAFVPWL SGQDMKDRMA KYARTANIFA LIRDQGSGEV KAEGRVTYRL    600
DKEDKESLRV GLRKALRILV AAGAMEVGTY RSDGQRIKCK GMKEEDLEEF LDTVTIVGGP    660
RSRNEVWTVF TTAHQMSSCR MGASEEEGAL DENGETWEAE GLYVCDGSVL PSAVGVNPMV    720
TIQSTSYCIA SKIAESLGKA STYS*                                          780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06970.0005587738158+
pfam05199GMC_oxred_C8.0e-22595723129+
COG2303BetA3.0e-26253735545+
pfam00732GMC_oxred_N2.0e-88280501225+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22878.10227441723alcohol oxidase [Glycine max]
EMBLCAN71289.1047392737hypothetical protein [Vitis vinifera]
EMBLCAP15763.1017391748long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
RefSeqXP_002285334.1047392737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002529832.1017391743electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jbv_B0.0000008422722226515A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism
PDB2jbv_A0.0000008422722226515A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism
PDB3nne_H0.0000009422722226515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0000009422722226515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.0000009422722226515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79475374527380
HO7792244482046500
HO8112163264157370
EL8930582904086970
FF3953972564757280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)