y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g37750.2
FamilyGH13
Protein PropertiesLength: 869 Molecular Weight: 98813 Isoelectric Point: 5.3623
ChromosomeChromosome/Scaffold: 19 Start: 44843020 End: 44861927
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133606807.3e-30
  LPRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEELKSLIDRAHELGLLVLMDIVHSHASNNTLDGLNMFDGTDGHYFHPGSRGYHWMWD
  SRLFNYGSWEVLRYLLSNARWWLDEYKFDGFRFDGVTSMMYTHHGLEVAFTGNYNEYFGFATDVDAVVYLMLTNDVIHGLFPEAVTIGEDVSGMPTFCLP
  TQDGGIGFDYRLHMAIADKWIEILKKNDEDWKMGDIIHTLTNRRWLEKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPIIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 869     Download
MVYTISGIRF PVLPSLHNSR FRGDRRTASL PVFLRNNSFS RKTLALKSSH DSDSLSSAIA    60
KSDKVLIPQD QDNSASLTDQ LETPDITSED TQNLEDLTME DEDKYNISEA ASSYRHIEDG    120
QGSVVSSLVD VNIPAKKASV SVGRKSKIVS DEVKPKIIPP PGTGQKIYEI DPSLLAHRDH    180
LDFRYGQYKR LCYEIDKHEG GLDTFSRGYE KFGFIRSATG ITYREWAPGA KSAALIGDFN    240
NWNPNADVMT RNEFGVWEIF LPNNVDGSPP IPHGSRVKIR MDTPSGIKDS IPAWIKFSVQ    300
APGEIPYSGI YYDPPEEEKY VFKHPQPKRP KSLRIYESHI GMSSPEPKIN TYVNFRDDVL    360
PRIKRLGYNA VQIMAIQEHS YYASFGYHVT NFFAPSSRFG TPEELKSLID RAHELGLLVL    420
MDIVHSHASN NTLDGLNMFD GTDGHYFHPG SRGYHWMWDS RLFNYGSWEV LRYLLSNARW    480
WLDEYKFDGF RFDGVTSMMY THHGLEVAFT GNYNEYFGFA TDVDAVVYLM LTNDVIHGLF    540
PEAVTIGEDV SGMPTFCLPT QDGGIGFDYR LHMAIADKWI EILKKNDEDW KMGDIIHTLT    600
NRRWLEKCVA YAESHDQALV GDKTIAFWLM DKDMYDFMAL DRPSTPIIDR GIALHKMIRL    660
ITMGLGGEGY LNFMGNEFGH PEWIDFPRGD QHLPNGVVVP GNNNSFDKCR RRFDLGDADY    720
LRYQGMQEFD QAMQHLEEKF GFMTAEHQYI SRKNEGDKII VFERGNLIFV FNFHWTNSYS    780
DYRVGCSTPG KYKIVLDSDD ALFGGFSRLN HAAEYFTSEG WYDDRPRSFL IYAPSRTAVV    840
YALADEAEPA LADATEPEPV DLDDKLLG*                                      900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029605.0e-818426184+
PLN03244PLN032441.0e-132269841580+
PLN02447PLN024470126841726+
cd11321AmyAc_bac_euk_BE0316731417+
PLN02960PLN029600269841576+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76444.1018611855starch branching enzyme II [Vigna radiata]
GenBankABO31358.1018451840starch branching enzyme II-1 [Malus x domestica]
DDBJBAA82348.2018611869starch branching enzyme [Phaseolus vulgaris]
EMBLCAA56319.1018621866starch branching enzyme I [Pisum sativum]
EMBLCBI30261.1018501857unnamed protein product [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A016785113700A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A016785113700A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B016785113700A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A016785113700A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D02048056577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366811618410
HO7776386272158410
HO4581233924508410
HO79453679881662e-19
HO777638471702160.00000000000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.1Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)