y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g38241.1
FamilyGT41
Protein PropertiesLength: 972 Molecular Weight: 108165 Isoelectric Point: 5.7077
ChromosomeChromosome/Scaffold: 19 Start: 45201700 End: 45219210
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT414088960
  IKPNFSQSLNNLGVVYTVQGKVDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGDIARAINAYEQCLKIDPDSRNAGQNRLLAMNYIEEGHDDTLFEVHR
  DWGRRFMRLYSQYTSWDNSKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYSNFKVIVYSAVVKADSKTIRFREKVVNKGGIWKDIYGIDEKMVANMV
  REDQVDILVELTGHTANNKLGMMACRPAPIQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELVRLPECFLCYTPSLEAGPVCPTPALSNGFVTF
  GSFNNLAKITPKVLQVWVRILCAIPNSRLVVKCKPFCSDSVRQIFLSTLEQLGLEPLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG
  VPCVTMAGSVHAHNVGVSLLSKVGLEHLIARNEDEYVELAQQLASDISALQNLRMSLRNLMSKSPLCDGAKFILGLESTYRNMWHRYCR
Full Sequence
Protein Sequence     Length: 972     Download
MLCYSYSFTL LPHSNFQNPN FFLEIFSSLP RFHFHCFFLR LVASIANSVT FFVQMAGADN    60
GDGNGSEREL AGNSDNGSVE VAEASVSDSG CEGNDSVSYA NVLRSRNKFV DALAIYERVL    120
ESDGANVEAL IGKGICLQMQ NKGRLAYESF SEAIKVDPQN ACALTHCGIL HKDEGRLVEA    180
AESYQKALQV DPSYKAAAEC LAIVLTDIGT NIKLAGNTQD GIQKYFEALK VDPHYAPAYY    240
NLGVVYSEMM QYDTALSFYE KAASERPVYA EAYCNMGVIF KNRGDLESAI TCYERCLTVS    300
PNFEIAKNNM AIALTDLGTK VKLEGDINQG VTLYKKALYY NWHYADAMYN LGVAYGEMLK    360
FDMAIVFYEL AFHFNPHCAE ACNNLGVIYK DRENLDKAVE CYQLALSIKP NFSQSLNNLG    420
VVYTVQGKVD AAASMIEKAI IANPTYAEAY NNLGVLYRDA GDIARAINAY EQCLKIDPDS    480
RNAGQNRLLA MNYIEEGHDD TLFEVHRDWG RRFMRLYSQY TSWDNSKDPE RPLVIGYVSP    540
DYFTHSVSYF IEAPLVYHDY SNFKVIVYSA VVKADSKTIR FREKVVNKGG IWKDIYGIDE    600
KMVANMVRED QVDILVELTG HTANNKLGMM ACRPAPIQVT WIGYPNTTGL PTIDYRITDS    660
LADPPETKQK HVEELVRLPE CFLCYTPSLE AGPVCPTPAL SNGFVTFGSF NNLAKITPKV    720
LQVWVRILCA IPNSRLVVKC KPFCSDSVRQ IFLSTLEQLG LEPLRVDLLP LILLNHDHMQ    780
AYSLMDISLD TFPYAGTTTT CESLYMGVPC VTMAGSVHAH NVGVSLLSKV GLEHLIARNE    840
DEYVELAQQL ASDISALQNL RMSLRNLMSK SPLCDGAKFI LGLESTYRNM WHRYCRGDVP    900
SLKRMELLQV ATGDLSNKNS EPTRIANSRE DSPGSVKANG FKTRPVSKLN IHSCEENDGS    960
SNHSSKQGKT S*                                                        1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00189TPR5.0e-17346445100+
cd00189TPR7.0e-1820430299+
cd00189TPR3.0e-1931341199+
cd00189TPR1.0e-22380479100+
COG3914Spy3.0e-90252894673+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtO820390559711932SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY
RefSeqXP_002281883.10559611914PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308458.10559711934predicted protein [Populus trichocarpa]
RefSeqXP_002323412.10559501911predicted protein [Populus trichocarpa]
RefSeqXP_002530535.10559711930o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1w3b_B5e-3613048637378A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B2e-2915548627344A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B7e-2710142075380A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B7e-2624250739329A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B0.00000000000897285207388A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2954084014758720
GT0417893373907260
GT0417891092173230.00000000001
GT0417891252814030.0000005
GT0417891073264300.000006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma03g35610.3Glyma03g35610.2Glyma02g36210.4
Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)