y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g38720.1
FamilyGT4
Protein PropertiesLength: 788 Molecular Weight: 89925 Isoelectric Point: 7.9189
ChromosomeChromosome/Scaffold: 19 Start: 45583914 End: 45589668
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45376436.7e-21
  FTKGAYFLGKMVWAKGYKELIDLLAKHKADLDGFKLDVFGNGEDANEVQSAARRLDLNLNFQKGRDHADDSLHRYKVFINPSISDVLCTATAEALAMGKF
  VVCADHP
Full Sequence
Protein Sequence     Length: 788     Download
MATHPQTPTS SNAFSFISKG WREVRDSADA DLRLMRDRAN SFKDLATSFD RELENFFNSA    60
TPPFSVPAMR SPPPKEIEFV KSLRPKLSEI RRAYSSPDFS KKVLEKWRPR TQIRINLSAI    120
KNAIVSAEEV GQEEEEGIVD FEKRRRRRLS FWEEWKNDGE GESRDWEPIR VLKTRFKEFE    180
KRGSSFEAFK NSEFVEKFKS SLKSMCKEPQ ESKEVPPLDV SELLAYIVKQ SGPFLDHLGV    240
KRDICDKIVE SLYSKCKNHH LLHTLSGEES SVLGNGNIND ELDLRIASVL QSTGHRYEGG    300
FWTDHAKHVP LDNERHVAIV TTASLPWMTG TAVNPLFRAA YLSQSAKQKV TLLVPWLCKS    360
DQELVYPSNV TFTSPEEQEA YIRSWLEERI GFKADFKISF YPGKFSKARR SIIPAGDTSQ    420
FIPSRDADIA ILEEPEHLNW YHHGKRWTDK FNHVVGIVHT NYLEYIKREK NGALQAFFVK    480
HINNWVTRAY CHKVLRLSAA TQDLPKSVIC NVHGVNPKFL KIGEKIAAER ELGQKAFTKG    540
AYFLGKMVWA KGYKELIDLL AKHKADLDGF KLDVFGNGED ANEVQSAARR LDLNLNFQKG    600
RDHADDSLHR YKVFINPSIS DVLCTATAEA LAMGKFVVCA DHPSNEFFRS FPNCLTYRTS    660
EDFVTKVKEA LENEPYPLTP EQRYQLSWEA ATQRFMEYSE LDGILNKENN GEKSRVDKGK    720
LIAKSASMPN LTELVDGGLA FAHYCLTGNE FLRLCTGAIP GTRDYDKQHC KDLHLLPPQV    780
ENPIYGW*                                                             840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00032argG2.0e-10443674259+
pfam00534Glycos_transf_13.0e-11543677142+
COG0438RfaG2.0e-11389699322+
PLN02501PLN0250102787798+
PLN02846PLN028460312778467+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA55727.1017871780digalactosyldiacylglycerol synthase 1 [Vigna unguiculata]
Swiss-ProtQ6DW74017871786DGDG1_LOTJA RecName: Full=Digalactosyldiacylglycerol synthase 1, chloroplastic; Flags: Precursor
Swiss-ProtQ6DW76017871783DGDG1_SOYBN RecName: Full=Digalactosyldiacylglycerol synthase 1, chloroplastic; Flags: Precursor
RefSeqXP_002264659.10578714797PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002533901.10107879797galactolipid galactosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2l7c_A0.004535553119A Chain A, Biophysical Studies Of Lipid Interacting Regions Of Dgd2 In Arabidopsis Thaliana
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesisRXN-1225EC-2.4.1.241digalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7953934043867880
HO780476441915200
GO8500173343066390
HO8031103491204680
GO8501463283666930
Orthologous Group
SpeciesID
Arabidopsis lyrata897369490510
Arabidopsis thalianaAT4G00550.1AT3G11670.1
Brachypodium distachyonBradi1g66940.1
Brassica rapaBra034821
Gossypium raimondiiGorai.002G235100.1
Manihot esculentacassava4.1_001948mcassava4.1_004529m
Mimulus guttatusmgv1a001509m
Panicum virgatumPavirv00006441m
Populus trichocarpaPotri.016G070200.2Potri.016G070200.1Potri.006G203200.4Potri.006G203200.3
Setaria italicaSi026023mSi026022m
Sorghum bicolorSb05g003730.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny