y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g41350.1
FamilyCE8
Protein PropertiesLength: 572 Molecular Weight: 64044.3 Isoelectric Point: 7.3983
ChromosomeChromosome/Scaffold: 19 Start: 47634349 End: 47636863
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82545510
  NVVVAQDGSGHFSTIADSLNACPKNKTIACVIYVKRGKYEERVVIPKGVKVFMYGDGPAHTIVSGTNTRDPRIVTTSFRAATFVVMGKGFICKDMGFTAP
  ADITGAPALLVLSDHAAFFNCKIDGNEGTLYAVAQRQFYRDCEILGSVDIIKGDSATVIQNSQIILKPRNSSDLVLRRNVMSAQSRLDKYQTTGLVIQNC
  TITAQKESMNTLNATTYLGSPYSEYSRTIIMESFLGDVIHPKGWCKWSDNYGIETATFWEFDNRGPGARTDKRVKWNGYSTIFERNQMVSYTVGRFLQ
Full Sequence
Protein Sequence     Length: 572     Download
MTLNYQRFGS YHNKMDSDNY SKEKEGMVLN IAIMVVSMIA IAMVTVSVVA HIDGSKQDAG    60
KNVKTLLSVC TKTEEPEICF RVLKHVGETA TVLNYVKAAI NATLTELLFV IRPKPRLERS    120
LTLLQQESYK DCLELLSLGK EELESLYLMA NFYVDLSELN LDDLLNSLSA VISYQHACTD    180
ELIRINSYGV LGYSLQVPIL LTRIALAIVD NFSERPNSRE PRRLEEFARW FSERERKMIE    240
SNQGDNGGEQ WPINVVVAQD GSGHFSTIAD SLNACPKNKT IACVIYVKRG KYEERVVIPK    300
GVKVFMYGDG PAHTIVSGTN TRDPRIVTTS FRAATFVVMG KGFICKDMGF TAPADITGAP    360
ALLVLSDHAA FFNCKIDGNE GTLYAVAQRQ FYRDCEILGS VDIIKGDSAT VIQNSQIILK    420
PRNSSDLVLR RNVMSAQSRL DKYQTTGLVI QNCTITAQKE SMNTLNATTY LGSPYSEYSR    480
TIIMESFLGD VIHPKGWCKW SDNYGIETAT FWEFDNRGPG ARTDKRVKWN GYSTIFERNQ    540
MVSYTVGRFL QADQWLLNRG IPYESGFVVL K*                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02314PLN023144.0e-85206565369+
PLN02301PLN023013.0e-85195566378+
PLN02468PLN024681.0e-89170567408+
PLN02745PLN027455.0e-10047566551+
pfam01095Pectinesterase1.0e-114254553305+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN67129.106254543541hypothetical protein [Vitis vinifera]
EMBLCBI26012.106356748567unnamed protein product [Vitis vinifera]
RefSeqXP_002274176.106256743563PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002275000.106357048570PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002519324.106656752567Pectinesterase-3 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02545674315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A02545678319A Chain A, Pectin Methylesterase From Carrot
PDB2nt9_B0.00000012545255315A Chain A, Pectin Methylesterase From Carrot
PDB2nt9_A0.00000012545255315A Chain A, Pectin Methylesterase From Carrot
PDB2nt6_B0.00000012545255315A Chain A, Pectin Methylesterase From Carrot
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
2850
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR1949612792845560
EC9517482663025630
EC9351782663025630
DY9189392892845660
DY9182312892845660
Orthologous Group
SpeciesID
Glycine maxGlyma03g38750.2
Medicago truncatulaMedtr7g111560.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny