y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma19g42370.1
FamilyGH2
Protein PropertiesLength: 972 Molecular Weight: 110195 Isoelectric Point: 6.0392
ChromosomeChromosome/Scaffold: 19 Start: 48378325 End: 48384858
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH247330
  QHRKTTLDSGWVAARSTEVQFTGIQLTTTHPPTRPTSPWMQALVPGTVLATLVKNKAVPDPFYGLQNEHIIDIADSGRDYYTFWFFTTFNCKLSSNEHCD
  LNFRGINYSADVYLNGHEIILPKGMFRRHSLDVTDILHSDGTNLLAVLVHPPDHPGRIPPEGGQGGDHEIGKDVTTQYVEGWDWMAPIRDRNTGIWDEVS
  ISVTGPVKIIDPHLVSTFSDDYKKAYLHTTTELENRSSLTAECSLSVQVTTELEDSICLVEHLQTQDLSIPANSAVQYTFPELFFSKPNLWWPNGMGKQS
  LYNVVIVIDVKGFGESDSWSHHFGFRKIESHIDDATGGRLFKVNGKPIFIRGGNWILSDGLLRLSKKRYNTDIKFHADMNFNMIRCWGGGLAERPEFYHY
  CDYYGLLVWQEFWITGDVDGRGDPVSNPNGPLDHDLFLFSARDTVKLLRNHPSLALWVGGNEQVPPDDINAALKNDLRLHPYFESVEENSKPVGDWSPMS
  TDFSQYLDGTRIYIQGSMWDGFADGKGNFTDGPYEIQNPEDFFKNHFYNYGFNPEVGSVGMPVAATIRATMPSEGWQIPVFKKLPNGYVEEVPNPIWEYH
  KYIPYSKPTKVHDQIQLYGDAKDLDDFCLKAQLVNYIQYRALLEGWTSRMWSKYTGVLIWKTQNPWTGLRGQFYDHLLDQTAGFYGCRCAAEPVHVQLNL
  ATYLIEVVNTTAEEMSNVAIEASVWDLDGT
Full Sequence
Protein Sequence     Length: 972     Download
MAEQHRKTTL DSGWVAARST EVQFTGIQLT TTHPPTRPTS PWMQALVPGT VLATLVKNKA    60
VPDPFYGLQN EHIIDIADSG RDYYTFWFFT TFNCKLSSNE HCDLNFRGIN YSADVYLNGH    120
EIILPKGMFR RHSLDVTDIL HSDGTNLLAV LVHPPDHPGR IPPEGGQGGD HEIGKDVTTQ    180
YVEGWDWMAP IRDRNTGIWD EVSISVTGPV KIIDPHLVST FSDDYKKAYL HTTTELENRS    240
SLTAECSLSV QVTTELEDSI CLVEHLQTQD LSIPANSAVQ YTFPELFFSK PNLWWPNGMG    300
KQSLYNVVIV IDVKGFGESD SWSHHFGFRK IESHIDDATG GRLFKVNGKP IFIRGGNWIL    360
SDGLLRLSKK RYNTDIKFHA DMNFNMIRCW GGGLAERPEF YHYCDYYGLL VWQEFWITGD    420
VDGRGDPVSN PNGPLDHDLF LFSARDTVKL LRNHPSLALW VGGNEQVPPD DINAALKNDL    480
RLHPYFESVE ENSKPVGDWS PMSTDFSQYL DGTRIYIQGS MWDGFADGKG NFTDGPYEIQ    540
NPEDFFKNHF YNYGFNPEVG SVGMPVAATI RATMPSEGWQ IPVFKKLPNG YVEEVPNPIW    600
EYHKYIPYSK PTKVHDQIQL YGDAKDLDDF CLKAQLVNYI QYRALLEGWT SRMWSKYTGV    660
LIWKTQNPWT GLRGQFYDHL LDQTAGFYGC RCAAEPVHVQ LNLATYLIEV VNTTAEEMSN    720
VAIEASVWDL DGTCPYYRVH ENFSLLPKKV APIFKMKYPE SKDPKPVYFL LLKLYNMSDN    780
RVISRNFYWL HLSGGDYKLL EPYREKKIPL KITSKVSIEE CTYNIQMLVA NTSKRPASTS    840
STARLSDGFY GTHSLETLAC GVGIEQKSSW FKRIHRCFAG KSDGLKVTEI SGPDVGVAFF    900
LHFSVHTSKM DHNEGKDTRI LPVHYSDNYF SLVPGETMPI NISFEVPLGV TPRVILHGWN    960
YDGGEIICEV V*                                                        1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10150PRK101501.0e-760487455+
PRK09525lacZ1.0e-8194465301+
pfam00703Glyco_hydro_22.0e-12210329120+
PRK10340ebgA3.0e-1799465382+
COG3250LacZ4.0e-4547688665+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82620.1079606965hypothetical protein [Vitis vinifera]
EMBLCBI36793.1079606943unnamed protein product [Vitis vinifera]
RefSeqXP_002284576.1079606965PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.1079676972predicted protein [Populus trichocarpa]
RefSeqXP_002512381.1079646969beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B03579074767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A03579074767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2x09_B03579074767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7939203643747350
GO8716003333016330
ES8327902995058030
CO9786802587159720
GO8476393515188640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny