y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g02800.3
FamilyGT65
Protein PropertiesLength: 437 Molecular Weight: 49766.3 Isoelectric Point: 8.1405
ChromosomeChromosome/Scaffold: 20 Start: 2377687 End: 2380129
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65733820
  GLNNQKIAFARACLTARRMNRILLMPSLSASLFYKEINLLQPISFDKVFQFDKFNQLCSGFVQLGQYSDLSNQTRVLEMQKGSGRKWTLERDLDQLREHS
  KGEFDEHEVIRIVGKNPFLWHDHWPVKDYAKVFECLVLIDEIGQEADRVVSRIRAVGRETQSNSESMELDNNDSSSFQPLPYVAVHMRVEIDWMIHCKKL
  EQRLNTNQICSSKKEIMERVSNIKGLKTPSVVYLAVADKLLQNSSVLEGWEEGFLPYEKNKLGVDGIYKKYPYLIQSAIDYEVCLRADIFVGNSFSTFST
  LIVLERTQKM
Full Sequence
Protein Sequence     Length: 437     Download
MGGGGGTVKS LTCKFVFLLV TLLILRALLV PPSPGFGGVV EWSNFVYIRN HSPSFGIGVR    60
QDKFLEVPQI VWGLNNQKIA FARACLTARR MNRILLMPSL SASLFYKEIN LLQPISFDKV    120
FQFDKFNQLC SGFVQLGQYS DLSNQTRVLE MQKGSGRKWT LERDLDQLRE HSKGEFDEHE    180
VIRIVGKNPF LWHDHWPVKD YAKVFECLVL IDEIGQEADR VVSRIRAVGR ETQSNSESME    240
LDNNDSSSFQ PLPYVAVHMR VEIDWMIHCK KLEQRLNTNQ ICSSKKEIME RVSNIKGLKT    300
PSVVYLAVAD KLLQNSSVLE GWEEGFLPYE KNKLGVDGIY KKYPYLIQSA IDYEVCLRAD    360
IFVGNSFSTF STLIVLERTQ KMITMGINMC GKDVRWPSYA YNIQQGESNG PMRWVTNMSH    420
STLQEISYGT NHIISC*                                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.0007649835+
cd11302O-FucT-10.0007253378146+
cd11299O-FucT_plant6.0e-1473379332+
cd11296O-FucT_like3.0e-24194379190+
pfam10250O-FucT1.0e-3973379338+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.30943615442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10114361427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.10914362347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.10914362347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.105843368444conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.000005253378212344A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution
PDB3zy5_A0.000005253378212344A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution
PDB3zy4_A0.000005253378212344A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution
PDB3zy3_B0.000005253378212344A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution
PDB3zy3_A0.000005253378212344A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution
Transmembrane Domains
StartEnd
1330
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK000039228412680
DW5174702701724370
DW5173972521724190
GW9648112362004350
GO8579223061334360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378Glyma07g34965.3.189.378
Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189Glyma07g34965.3.70.189
Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny