y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g03250.3
FamilyGT35
Protein PropertiesLength: 979 Molecular Weight: 111864 Isoelectric Point: 5.0053
ChromosomeChromosome/Scaffold: 20 Start: 2942367 End: 2952383
DescriptionGlycosyl transferase, family 35
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT355629730
  NKIELKFKVDPKLPMMVRMANLCVVGGFSVNGVAEIHSKIVKEEVFDEFYKLWPEKFQNKTNGVTPRRWIRFCNPDLSKIITKWIGTEDWVTDLEKLAIL
  RKFADNEDLQLEWIEAKRRNKIRVASFLKEKTGYVVNPNAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKELSAEERKDMFVPRVCIFGGKAFATYVQAK
  RIVKFITDVGATINSDPEIGDLLKVVFVPDYNVSVAEMLIPGSESSQHISTAGMEASGTSNMKFAMNGCIVIGTLDGANVEIREEVGEDNFFLFGARAQE
  IVGLRKERVEGKFVPDPRFEEVKAYVRSGVFGPYNYEELMGSLEGNEGYGRADYFLVGKDFPSYLECQEEVDKAYHDQKRWTKMSILNTAGSFKFSSDRT
  IHEYARDIWRIE
GT351694930
  ALRKLGHNLEDVANKEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQHITKDGQVEVAENWLEMGNPWEILKNDVSYPVKFYGEVISGP
  NGSKQWVGGENILAVAYDVPIPGYKTRTTINLRLWSTKVSPEEFDLQAYNSGDHAKAYAVMKNAEKICYVLYPGDESIDGKTLRLKQQYTLCSASLQDIF
  ARFERRLGKRVNWDTLPDKVVVQMNDTHPTLCIPEIIRILVDVKGLSWEKAWNITKRTVAYTNHTILPEALEKWSLTLLQDLLPRHMEIIRKIDEELINE
  IISEYGIDDLDLFQQRLKKMRILEN
Full Sequence
Protein Sequence     Length: 979     Download
MAALPFSTTC RHSNSPLHHN SKTSFIGFSQ RNNIWQLFVI TKSNSRRAIR KLCVKNVTSD    60
KKQELEEPLN EQDTFNEFVP DSASIASSIK FHAEFTSPFS PEKFELNKAF FATAESVRDS    120
LIINWNATND YYERMNVKQA YYMSMEYLQG RALLNAIGNL QLSGPYAEAL RKLGHNLEDV    180
ANKEPDAALG NGGLGRLASC FLDSLATLNY PAWGYGLRYK YGLFKQHITK DGQVEVAENW    240
LEMGNPWEIL KNDVSYPVKF YGEVISGPNG SKQWVGGENI LAVAYDVPIP GYKTRTTINL    300
RLWSTKVSPE EFDLQAYNSG DHAKAYAVMK NAEKICYVLY PGDESIDGKT LRLKQQYTLC    360
SASLQDIFAR FERRLGKRVN WDTLPDKVVV QMNDTHPTLC IPEIIRILVD VKGLSWEKAW    420
NITKRTVAYT NHTILPEALE KWSLTLLQDL LPRHMEIIRK IDEELINEII SEYGIDDLDL    480
FQQRLKKMRI LENIELPNSV MELLSITEET PAVDPVKEID VDDTDVKATE KEDGDDDDDY    540
EVVEEEQEED NEEPSVEEDT SNKIELKFKV DPKLPMMVRM ANLCVVGGFS VNGVAEIHSK    600
IVKEEVFDEF YKLWPEKFQN KTNGVTPRRW IRFCNPDLSK IITKWIGTED WVTDLEKLAI    660
LRKFADNEDL QLEWIEAKRR NKIRVASFLK EKTGYVVNPN AMFDVQVKRI HEYKRQLLNI    720
LGIVYRYKKM KELSAEERKD MFVPRVCIFG GKAFATYVQA KRIVKFITDV GATINSDPEI    780
GDLLKVVFVP DYNVSVAEML IPGSESSQHI STAGMEASGT SNMKFAMNGC IVIGTLDGAN    840
VEIREEVGED NFFLFGARAQ EIVGLRKERV EGKFVPDPRF EEVKAYVRSG VFGPYNYEEL    900
MGSLEGNEGY GRADYFLVGK DFPSYLECQE EVDKAYHDQK RWTKMSILNT AGSFKFSSDR    960
TIHEYARDIW RIEPVELA*                                                 1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase6.0e-129169506338+
cd04300GT1_Glycogen_Phosphorylase3.0e-17986493412+
cd04300GT1_Glycogen_Phosphorylase0577972401+
pfam00343Phosphorylase0578974402+
TIGR02093P_ylase0577972401+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27267.1019751930unnamed protein product [Vitis vinifera]
Swiss-ProtP5353505897754973PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L-2; Flags: Precursor
RefSeqXP_002274575.1019751978PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316098.1019771952predicted protein [Populus trichocarpa]
RefSeqXP_002512108.1019771972glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A0578974440830A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB1z8d_A011051953459A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_B0578971404793A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_B013646257375A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_A0578971404793A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1826EC-2.4.1.1phosphorylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7783038731099770
HO7971783995799770
HO6207674015779770
HO6139544015779770
HO77830395211110.00001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)