y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g04645.2
FamilyGH18
Protein PropertiesLength: 801 Molecular Weight: 89019.8 Isoelectric Point: 7.8131
ChromosomeChromosome/Scaffold: 20 Start: 4946074 End: 4950402
Descriptionlectin protein kinase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18282513.3e-21
  DIAIYWGSNDGEGSLAETCATGLYSFVNIAFLAHFGNGQVPQVILGRHCDPFGGNCSVLGRDIRNCQKQGIKVMLSIGGPSMSYSLVSSEDAKSVSDYLW
  NNFLGGGGNSSSSSSPLGDVILDGIDFGLGGSLMTKHWEDLAHYLKSHRRNVYLSAAPQCIFPDSALGKALETGLFDYVWIQFYNNPLCQYNEGNASNLL
  NAWKQWTTSLKSGKMFLGLPASPT
Full Sequence
Protein Sequence     Length: 801     Download
MNMFLFPSYV LLLLFLILNL PHTTHSDDIA IYWGSNDGEG SLAETCATGL YSFVNIAFLA    60
HFGNGQVPQV ILGRHCDPFG GNCSVLGRDI RNCQKQGIKV MLSIGGPSMS YSLVSSEDAK    120
SVSDYLWNNF LGGGGNSSSS SSPLGDVILD GIDFGLGGSL MTKHWEDLAH YLKSHRRNVY    180
LSAAPQCIFP DSALGKALET GLFDYVWIQF YNNPLCQYNE GNASNLLNAW KQWTTSLKSG    240
KMFLGLPASP TASIGGYVPP DLLISRILST VKTSSNYGGI MLWSRLFDKE SGYSKRILEN    300
SVCLQKRETE CGRHKNGFIE HLGYMAKEGF VASESKSIDM QCCEVICRNN CSCEAYAPLN    360
FVNNTGCQFW GKGTKFIKDS GGNFKRVYFV KHKVNKLWKW IVIGVGAAVA ALVSCYLFYV    420
LRRKCKEEVD RKMKRKELLV EVGGNAMGNY GKAKGSKKEG KTINEIEVFS LENIIVATHN    480
FSPDNKLGEG GFGPVYKGTL IDGQEIAIKR LSKSSGQGLV EFKNEAKIMA KLQHTNLVRL    540
LGFCIDSDER ILVYEYMSNK SLDHYLFDAS RNNELEWNKR LKIIEGTAQG LVYLHRYSRL    600
KVIHRDLKAS NILLDEEMNP RISDFGLARI FGLKGSEENT SRVVGTYGYM SPEYAINGVV    660
SVKTDVYSFG VLLLEIISGM KNNSCIHSNH PFNLIAHAWQ LWNQGRALEL MDPSLNESFS    720
SDEVERCIQI GLLCVQDHAI ERPTMEDVVT FLSNDTTQLG QPKQPAFFMY VVAGESGCPN    780
NSKQENYSLN HLSISTAYGR *                                              840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00069Pkinase2.0e-50486749269+
smart00221STYKc9.0e-51484752285+
smart00219TyrKc9.0e-51484752285+
cd00180PKc7.0e-51487676194+
cd02877GH18_hevamine_XipI_class_III1.0e-11128297281+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005975carbohydrate metabolic process
GO:0006468protein phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI25711.10303800107619unnamed protein product [Vitis vinifera]
RefSeqXP_002268267.1043076714351PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268342.10296767288764PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002516064.10303800300795Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
RefSeqXP_002516068.10281800271789receptor protein kinase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1kr1_A0293003272A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag
PDB1kqz_A0293003272A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag
PDB1kqy_A0293003272A Chain A, Hevamine Mutant D125aE127AY183F IN COMPLEX WITH PENTA-Nag
PDB2hvm_A0293003272A Chain A, Hevamine Mutant D125aE127AY183F IN COMPLEX WITH PENTA-Nag
PDB1llo_A0293003272A Chain A, Hevamine Mutant D125aE127AY183F IN COMPLEX WITH PENTA-Nag
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Transmembrane Domains
StartEnd
400422
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY9784162874697550
HO7839103384648010
GO8383982934657570
EX0926282804717480
FE6991312954547430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01441.1Aquca_229_00003.1Aquca_037_00022.1Aquca_002_01440.1Aquca_020_00079.1
Aquca_011_00549.1
Arabidopsis lyrata489265
Arabidopsis thalianaAT5G24090.1
Brachypodium distachyonBradi2g55630.1Bradi1g52625.1Bradi2g55610.1Bradi2g55620.1Bradi2g43755.1
Bradi2g47066.1Bradi2g45610.1
Brassica rapaBra026469Bra009731
Carica papayaevm.model.supercontig_184.10evm.model.supercontig_1833.1evm.model.supercontig_3.30evm.model.supercontig_80.46evm.model.supercontig_3.24
evm.model.supercontig_3.21evm.model.supercontig_3.23evm.TU.contig_34078.1
Capsella rubellaCarubv10001507m
Citrus clementinaCiclev10005491mCiclev10024434mCiclev10005522m
Citrus sinensisorange1.1g035598morange1.1g044801morange1.1g043511m
Cucumis sativusCucsa.201870.1Cucsa.258800.1Cucsa.201840.1Cucsa.201850.1Cucsa.258820.1
Cucsa.201860.1
Eucalyptus grandisEucgr.E00091.1Eucgr.E00086.1Eucgr.E00090.1Eucgr.K00308.1Eucgr.K00311.1
Eucgr.H04884.1Eucgr.L03478.1Eucgr.K00313.1
Fragaria vescamrna15598.1-v1.0-hybridmrna18987.1-v1.0-hybridmrna18986.1-v1.0-hybridmrna18999.1-v1.0-hybridmrna13147.1-v1.0-hybrid
mrna13194.1-v1.0-hybridmrna13136.1-v1.0-hybrid
Glycine maxGlyma12g25740.1Glyma16g28970.1Glyma16g28970.2Glyma18g15310.2Glyma10g37200.1
Glyma18g15230.1Glyma20g30480.1Glyma09g23136.1Glyma20g30450.1Glyma02g12660.1
Glyma01g06720.1Glyma03g41510.1Glyma07g06760.1Glyma18g15330.1Glyma08g41100.1
Glyma15g01820.4Glyma15g01820.3Glyma15g01820.2Glyma20g04645.1Glyma19g22510.1
Glyma05g07193.1Glyma20g30460.1
Gossypium raimondiiGorai.004G154400.1Gorai.008G118600.1Gorai.008G128500.1Gorai.008G272100.1Gorai.008G272000.1
Gorai.004G116500.1Gorai.009G389400.1Gorai.003G123100.1Gorai.009G389700.1
Linum usitatissimumLus10040420Lus10009216Lus10040419Lus10023535Lus10037985
Lus10009215Lus10023534Lus10037984Lus10010137Lus10001868
Malus domesticaMDP0000192511MDP0000888042MDP0000789304MDP0000940313MDP0000507853
MDP0000290970MDP0000218691MDP0000287581MDP0000414607MDP0000280265
MDP0000275926MDP0000222724MDP0000217803MDP0000218640MDP0000286587
MDP0000162677MDP0000275771MDP0000179027MDP0000310481MDP0000276435
MDP0000216662MDP0000841470
Manihot esculentacassava4.1_012935mcassava4.1_025190mcassava4.1_034267mcassava4.1_029485mcassava4.1_023457m
cassava4.1_026904mcassava4.1_027845mcassava4.1_012979mcassava4.1_028683mcassava4.1_012830m
Medicago truncatulaMedtr1g099310.1Medtr8g055940.1Medtr1g099290.1Medtr5g043550.1Medtr1g099320.1
Medtr1g099350.1Medtr2g102020.1Medtr7g116850.1Medtr7g116350.1Medtr6g023340.1
Mimulus guttatusmgv1a021044mmgv1a011049mmgv1a022607mmgv1a013181m
Oryza sativaLOC_Os01g47070.1LOC_Os07g19040.1LOC_Os01g64110.1LOC_Os01g64100.1LOC_Os01g49320.1
LOC_Os01g19750.1LOC_Os04g27980.1LOC_Os07g23850.1
Panicum virgatumPavirv00056413mPavirv00047799mPavirv00036743mPavirv00000209mPavirv00002369m
Pavirv00041282mPavirv00062095mPavirv00042577mPavirv00036741mPavirv00047846m
Pavirv00062097mPavirv00062098mPavirv00036739mPavirv00049525mPavirv00009907m
Pavirv00003256mPavirv00064592m
Phaseolus vulgarisPhvul.011G167300.1Phvul.004G101500.1Phvul.002G069300.1Phvul.003G049100.1Phvul.007G077800.1
Phvul.003G049000.1Phvul.006G109000.1Phvul.011G167000.1Phvul.011G166900.1
Populus trichocarpaPotri.015G023900.1Potri.015G024100.1Potri.015G024000.1Potri.012G033900.1Potri.014G091700.1
Potri.002G165700.1Potri.015G024200.1Potri.002G242000.1Potri.014G092800.1Potri.014G091600.1
Prunus persicappa009328mppa024550mppa021993mppa026927mppa022614m
ppa015812mppa023419mppa009248mppa023573m
Ricinus communis30169.m00655630174.m00867730169.m00655729717.m00023029595.m000280
30174.m00867830174.m008684
Setaria italicaSi033231mSi002396mSi002395mSi002419mSi002402m
Si039207mSi002411mSi003958mSi004596m
Selaginella moellendorffii12620315257232123231185409562.377.598
409562.377.598232630409562.48.270409562.48.27092194
236715
Sorghum bicolorSb03g030100.1Sb02g009370.1Sb02g009360.1Sb02g009380.1Sb03g040600.1
Sb02g009390.1Sb03g040570.1Sb01g050530.1Sb03g040560.1Sb03g040580.1
Sb03g040590.1Sb03g031710.1
Thellungiella halophilaThhalv10004675m
Vitis viniferaGSVIVT01027027001GSVIVT01028752001GSVIVT01027012001GSVIVT01028750001GSVIVT01032411001
GSVIVT01027014001GSVIVT01027022001GSVIVT01027026001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)