y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g06820.1
FamilyGH9
Protein PropertiesLength: 631 Molecular Weight: 70751.2 Isoelectric Point: 9.2155
ChromosomeChromosome/Scaffold: 20 Start: 9346707 End: 9353417
DescriptionSix-hairpin glycosidases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91185910
  NYTLALHKALLFFNAQKSGRLPKSNGIPWRGNSGLNDGNDTTDVKGGLVGGYYDAGDNTKFHFPMAFAMTMLSWSVLEYKQKYMAINEYAHTRELIKWGT
  DYLLLTFNNSATKIDKIYGQVGGSLNGSTTPDDHYCWQRPEDMEYQRRTISIHQGADLAGEMAAALASASIVFQDDVAYSKKLIKGAQTVFDFARDSGKR
  KPYSRGEPYIEPFYNSSGYYDEYMWGAAWLYYATGNSTYISLATNPSIFKNSKAYFLTPDFSVLSWDNKLPAAMLLLTRFRMFLNPGYPYEDMLKMYHNV
  TSLTMCSYLHHYKVFNRTRGGLIQLNHGQPQSLQYAANAAFMASLFADYMLEIDVPGWQCGSTYFPISALKAFATSQIEYILGKNPMKMSYIVGFGNKFP
  KHVHHRGASIPNDHKHRSCTGGWKWRDTPNPNPNTITGAMVGGPDRFDQFRDSRKNYNFTEPTLAGNAGLVAAL
Full Sequence
Protein Sequence     Length: 631     Download
MHSRNNWGGS FEMSSSGEEV SGYEANNNHN KEWDRAALLE RYHPQSQDLD ETLQSWVLGR    60
GEKSKKTKYV DFGCIMISHK ALKWLFGSIF LAFIVIGLPI IIVKSLPKHH SPPTPPDNYT    120
LALHKALLFF NAQKSGRLPK SNGIPWRGNS GLNDGNDTTD VKGGLVGGYY DAGDNTKFHF    180
PMAFAMTMLS WSVLEYKQKY MAINEYAHTR ELIKWGTDYL LLTFNNSATK IDKIYGQVGG    240
SLNGSTTPDD HYCWQRPEDM EYQRRTISIH QGADLAGEMA AALASASIVF QDDVAYSKKL    300
IKGAQTVFDF ARDSGKRKPY SRGEPYIEPF YNSSGYYDEY MWGAAWLYYA TGNSTYISLA    360
TNPSIFKNSK AYFLTPDFSV LSWDNKLPAA MLLLTRFRMF LNPGYPYEDM LKMYHNVTSL    420
TMCSYLHHYK VFNRTRGGLI QLNHGQPQSL QYAANAAFMA SLFADYMLEI DVPGWQCGST    480
YFPISALKAF ATSQIEYILG KNPMKMSYIV GFGNKFPKHV HHRGASIPND HKHRSCTGGW    540
KWRDTPNPNP NTITGAMVGG PDRFDQFRDS RKNYNFTEPT LAGNAGLVAA LISLTSTTGS    600
GIDRNTIFSA IPPLGPQNPP PPPPWKPIKT *                                   660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02266PLN022663.0e-10276599538+
PLN02340PLN023407.0e-10393600522+
PLN02613PLN026139.0e-109117606504+
PLN02345PLN023452.0e-130122597489+
pfam00759Glyco_hydro_92.0e-144118591480+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACT54547.1016111612endo-1,4-beta-glucanase [Dimocarpus longan]
RefSeqXP_002266444.1016111603PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312211.1016271620predicted protein [Populus trichocarpa]
RefSeqXP_002315101.1016111605predicted protein [Populus trichocarpa]
RefSeqXP_002514768.1016111608endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A01185964430B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1ksc_A01185964430B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1ks8_A01185964430A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A01066009465B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B01155992445B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Transmembrane Domains
StartEnd
84103
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794674570466110
BF010444588326110
HO7962134771406110
HO778339455515010
HO7783391115016110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032858221894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma06g12910.2
Glyma06g12910.3Glyma04g41891.1
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.2Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10012162Lus10026863Lus10018918Lus10028619
Lus10010029Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1Phvul.009G135900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)