y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g15800.1
FamilyGH9
Protein PropertiesLength: 139 Molecular Weight: 15404.6 Isoelectric Point: 9.3723
ChromosomeChromosome/Scaffold: 20 Start: 21569219 End: 21569733
Descriptionglycosyl hydrolase 9A4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9301298.7e-29
  NYKEALTKGTTFNEAQCTRKYSANTRKLPSNNRVPWRGDSTLDDGKLANVDLVGGYYDAGDNVKYGLPMAFTVTTLAWGAIFYKSEFKAANELDNIQDAI
Full Sequence
Protein Sequence     Length: 139     Download
MGTKQVCWAI IVVWLTLLEG NTMLVKGDFN YKEALTKGTT FNEAQCTRKY SANTRKLPSN    60
NRVPWRGDST LDDGKLANVD LVGGYYDAGD NVKYGLPMAF TVTTLAWGAI FYKSEFKAAN    120
ELDNIQDAIL KASSRHKR*                                                 180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN021714.0e-3330129100+
PLN02340PLN023403.0e-3329129101+
PLN02613PLN026134.0e-349129121+
pfam00759Glyco_hydro_92.0e-3630129102+
PLN02909PLN029092.0e-519138142+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82881.11e-392813812122hypothetical protein [Vitis vinifera]
EMBLCAN82882.13e-402713829140hypothetical protein [Vitis vinifera]
EMBLCBI20730.14e-381138486625unnamed protein product [Vitis vinifera]
EMBLCBI20730.15.04467e-44913810140unnamed protein product [Vitis vinifera]
RefSeqNP_189972.22e-372113824142AtGH9A4 (Arabidopsis thaliana Glycosyl Hydrolase 9A4); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4tf4_B6e-2429127495A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB4tf4_A6e-2429127495A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3tf4_B6e-2429127495A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3tf4_A6e-2429127495A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB1tf4_B6e-2429127495A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Transmembrane Domains
StartEnd
725
94111
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GH29273413971382.00386e-43
FD987004118281384.99997e-41
EX067724117291389.99995e-41
CO12601412911299.99995e-41
EH767938137111382e-40