y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g20260.1
FamilyGT24
Protein PropertiesLength: 134 Molecular Weight: 15463.4 Isoelectric Point: 4.4596
ChromosomeChromosome/Scaffold: 20 Start: 28732575 End: 28733567
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2427785.2e-28
  FFDLPNYAQHTVPIFSLPQEWIWCESWCGNATKYKAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 134     Download
KEIHERPVDG IRIPIYFPLT FCLLNAFFDL PNYAQHTVPI FSLPQEWIWC ESWCGNATKY    60
KAKTIDLCNN PMTKEPKLRI VSEWPDLDFE ARRFTARILG DDQESESIQP PNQSKDLNSE    120
GSSNEDMESR VEL*                                                      180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00505Glyco_transf_80.0001237862+
cd06432GT8_HUGT1_C_like6.0e-31297850+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.14.99997e-412713315581674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
EMBLCBI23772.17.00005e-412913316061715unnamed protein product [Vitis vinifera]
RefSeqNP_001047660.14.00001e-4129127139242Os02g0664200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_177278.39.99995e-412913314991613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.17.00005e-412913315021611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AW472251116231340
BM17810812591260
BI427636116231340
GR403235116231340
GR402289116231340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma05g30230.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny