y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g26270.2
FamilyAA1
Protein PropertiesLength: 567 Molecular Weight: 64198.2 Isoelectric Point: 9.0874
ChromosomeChromosome/Scaffold: 20 Start: 35769649 End: 35774520
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1923552.5e-24
  ATVPGPTIEAIYGVDTHVRWQNHLPPKHILPWDPTIPTAMTNSTRGIPTVVHLHGGIHAPESDGNANAWFTSKYNERGPTWTKKTYHYPNNQQPGNLWYH
  DHAMGLTRVNLLAGLLGAYIIRHPQIEDPLGLPSGDEFDRTLIVFDRSFRTDGSIFMSSTGNNPKIHPQWQPEYFGDAIIVNGKAWPRLTVRRRKYRFRI
  INASNARFFRFFFTNGLRFTHVASDSAYIEKPVTTNETLVGPSEITDIVVDFSQSKSNLAILAN
Full Sequence
Protein Sequence     Length: 567     Download
MDTRTLLLKL LITLVALSGC SSSASDHLVN VSKLEKFVDE LPHMPKILGY HLSDGVPKSK    60
SLKIGMFKKK WKFHRDLAPA TVYAFGTTKH TATVPGPTIE AIYGVDTHVR WQNHLPPKHI    120
LPWDPTIPTA MTNSTRGIPT VVHLHGGIHA PESDGNANAW FTSKYNERGP TWTKKTYHYP    180
NNQQPGNLWY HDHAMGLTRV NLLAGLLGAY IIRHPQIEDP LGLPSGDEFD RTLIVFDRSF    240
RTDGSIFMSS TGNNPKIHPQ WQPEYFGDAI IVNGKAWPRL TVRRRKYRFR IINASNARFF    300
RFFFTNGLRF THVASDSAYI EKPVTTNETL VGPSEITDIV VDFSQSKSNL AILANDAKYP    360
YPAGDPVNEA NGKVIKFIIV PDQEVDTSRV PKRLLEYPVV DLSSVAHTRY VAMYEYASDI    420
DEPTHLYLNA KPYEAAATET PKVGSTEVWY VINLTEDNHP LHIHLGLFKV LDQTALVKPD    480
DEFRECMKKI NDAVKCHVDK YARGKKEEVP AHERGWKNVF KMIPGHVTKI AVRFSYIHTN    540
ASYVFDATTE PGYVYHCHVK YTYHFF*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10965PRK109650.0001442559120+
PRK10883PRK108832.0e-10180357185+
pfam07732Cu-oxidase_32.0e-1076213151+
PRK10965PRK109654.0e-13139348217+
COG2132SufI2.0e-2891559479+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN78466.102655925557hypothetical protein [Vitis vinifera]
EMBLCBI26921.1024559104638unnamed protein product [Vitis vinifera]
RefSeqXP_002284144.102155924561PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315892.102555924557predicted protein [Populus trichocarpa]
RefSeqXP_002531069.1015591559spore coat protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0345593494A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2x88_A0345593494A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2x87_A0345593494A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0345593494A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0345593494A Chain A, Crystal Structure Of The Reconstituted Cota
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093503575590
HO7965214411195590
BW656235239182560
ES833412312193300
EY8239072941624550
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.1Glyma10g41010.1
Gossypium raimondiiGorai.005G162700.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny