y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g26270.3
FamilyAA1
Protein PropertiesLength: 533 Molecular Weight: 60439.9 Isoelectric Point: 9.2041
ChromosomeChromosome/Scaffold: 20 Start: 35767719 End: 35774520
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1493122.1e-24
  ATVPGPTIEAIYGVDTHVRWQNHLPPKHILPWDPTIPTAMTNSTRGIPTVVHLHGGIHAPESDGNANAWFTSKYNERGPTWTKKTYHYPNNQQPGNLWYH
  DHAMGLTRVNLLAGLLGAYIIRHPQIEDPLGLPSGDEFDRTLIVFDRSFRTDGSIFMSSTGNNPKIHPQWQPEYFGDAIIVNGKAWPRLTVRRRKYRFRI
  INASNARFFRFFFTNGLRFTHVASDSAYIEKPVTTNETLVGPSEITDIVVDFSQSKSNLAILAN
Full Sequence
Protein Sequence     Length: 533     Download
MPKILGYHLS DGVPKSKSLK IGMFKKKWKF HRDLAPATVY AFGTTKHTAT VPGPTIEAIY    60
GVDTHVRWQN HLPPKHILPW DPTIPTAMTN STRGIPTVVH LHGGIHAPES DGNANAWFTS    120
KYNERGPTWT KKTYHYPNNQ QPGNLWYHDH AMGLTRVNLL AGLLGAYIIR HPQIEDPLGL    180
PSGDEFDRTL IVFDRSFRTD GSIFMSSTGN NPKIHPQWQP EYFGDAIIVN GKAWPRLTVR    240
RRKYRFRIIN ASNARFFRFF FTNGLRFTHV ASDSAYIEKP VTTNETLVGP SEITDIVVDF    300
SQSKSNLAIL ANDAKYPYPA GDPVNEANGK VIKFIIVPDQ EVDTSRVPKR LLEYPVVDLS    360
SVAHTRYVAM YEYASDIDEP THLYLNAKPY EAAATETPKV GSTEVWYVIN LTEDNHPLHI    420
HLGLFKVLDQ TALVKPDDEF RECMKKINDA VKCHVDKYAR GKKEEVPAHE RGWKNVFKMI    480
PGHVTKIAVR FSYIHTNASY VFDATTEPGY VYHCHVLDHE DNAMMRPLKI IK*           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10965PRK109654.0e-10399525129+
PRK10883PRK108832.0e-10137314185+
pfam07732Cu-oxidase_32.0e-1033170151+
PRK10965PRK109655.0e-1396305217+
COG2132SufI1.0e-3448530493+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN78466.10153243573hypothetical protein [Vitis vinifera]
EMBLCBI26921.101532124654unnamed protein product [Vitis vinifera]
RefSeqXP_002284144.10153247577PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315892.10153143572predicted protein [Populus trichocarpa]
RefSeqXP_002531069.10153245575spore coat protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A02053029508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2x88_A02053029508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2x87_A02053029508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A02053029508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A02053029508A Chain A, Crystal Structure Of The Reconstituted Cota
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093520145330
HO796521458765330
EY8239072941194120
EY7055082941124050
HE6434853111134230
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.2Glyma20g26270.1Glyma10g41010.1
Gossypium raimondiiGorai.005G162700.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny