y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g29080.1
FamilyGH29
Protein PropertiesLength: 488 Molecular Weight: 55678.3 Isoelectric Point: 7.8699
ChromosomeChromosome/Scaffold: 20 Start: 38016411 End: 38018957
Descriptionalpha-L-fucosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29433410
  SQLQWQQREIIMFLHFGVNTFTDREWGTGQENPAIFNPTGLNTTQWATVAADAGVSLMILTAKHHDGFCLWPSKYTDHSVISSPWQGGKGDVVQDFVNAA
  TAQGIDVGIYLSPWDRHDPRYGNDLLYNQYYLAQLQELLKKYSNVREIWFDGAKGANAKNMTYYFSDWFSMVKELQSSINIFSDAGPDVRWVGDETGSAG
  YTCWSTINRTSLSIGSPDIIQYINTGDPKGTDWLPAECDVSIRHGWFWHKSESPKKLSELLDIYYNSVGRNCVLLLNVPPNTSGLITEADANRLKEFRS
Full Sequence
Protein Sequence     Length: 488     Download
MVRLWCSSLL MTILFQQLIR LCISWSVQTP TPPLPILPLP TYSQLQWQQR EIIMFLHFGV    60
NTFTDREWGT GQENPAIFNP TGLNTTQWAT VAADAGVSLM ILTAKHHDGF CLWPSKYTDH    120
SVISSPWQGG KGDVVQDFVN AATAQGIDVG IYLSPWDRHD PRYGNDLLYN QYYLAQLQEL    180
LKKYSNVREI WFDGAKGANA KNMTYYFSDW FSMVKELQSS INIFSDAGPD VRWVGDETGS    240
AGYTCWSTIN RTSLSIGSPD IIQYINTGDP KGTDWLPAEC DVSIRHGWFW HKSESPKKLS    300
ELLDIYYNSV GRNCVLLLNV PPNTSGLITE ADANRLKEFR SAINTIFHQN LAEDCFVKVS    360
SQRRGFGPEK MLDSEHLWSY WAPRDDDGEK DHWIEIWAKE GKFRFNVIRI QEAIGLGQRI    420
KRHEIYVDGK LIIKATTVGY KRLHRLNGGE VHARVVRIRI RKARGVPLIS SIGLHYDPFW    480
HSKFTPT*                                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01120Alpha_L_fucos3.0e-2478339277+
smart00812Alpha_L_fucos2.0e-2554339331+
COG3669COG36692.0e-5444474442+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270630.104348122461PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270674.10314797458PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318264.1014851485predicted protein [Populus trichocarpa]
RefSeqXP_002322431.1014811482predicted protein [Populus trichocarpa]
RefSeqXP_002510887.1014811482alpha-l-fucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3eyp_B0354755454A Chain A, Crystal Structure Of Putative Alpha-L-Fucosidase From Bacteroides Thetaiotaomicron
PDB3eyp_A0354755454A Chain A, Crystal Structure Of Putative Alpha-L-Fucosidase From Bacteroides Thetaiotaomicron
PDB3ues_B04047019471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A04047019471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B04047021473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW9090412981924880
EV2777382442064490
CX0441712941364240
DR9218682981884810
HE64264333913390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1Bradi5g18220.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna28904.1-v1.0-hybridmrna13376.1-v1.0-hybrid
Glycine maxGlyma12g30151.1Glyma13g39750.2Glyma10g38670.2Glyma10g38670.1
Gossypium raimondiiGorai.004G231200.1Gorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1Phvul.005G131200.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)