y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g30910.1
FamilyAA2
Protein PropertiesLength: 357 Molecular Weight: 38915.5 Isoelectric Point: 7.2628
ChromosomeChromosome/Scaffold: 20 Start: 39574060 End: 39576581
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2543180
  SIVRSELKKVFNKDIAQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPGEKEAPPNLTLRPEAFKIIENLRGLLEKSCGRVVSCSDITALTARDAVFLSGG
  PDYEIPLGRRDGLTFATRQVTLDNLPPPSSNASTILSSLATKNLDPTDVVALSGGHTIGISHCSSFTNRLYPTQDPVMDKTFGNNLRRTCPAANTDNTTV
  LDIRSPNTFDNKYYVDLLNRQGLFTSDQDLYTDKRTKGIVSDFAVNQNLFFEKFVFAMLKMGQLN
Full Sequence
Protein Sequence     Length: 357     Download
MASISCMSAI LSFLLISIFL SVYNIEVCEA QARPPTAKGL SYTFYDKSCP KLKSIVRSEL    60
KKVFNKDIAQ AAGLLRLHFH DCFVQGCDGS VLLDGSASGP GEKEAPPNLT LRPEAFKIIE    120
NLRGLLEKSC GRVVSCSDIT ALTARDAVFL SGGPDYEIPL GRRDGLTFAT RQVTLDNLPP    180
PSSNASTILS SLATKNLDPT DVVALSGGHT IGISHCSSFT NRLYPTQDPV MDKTFGNNLR    240
RTCPAANTDN TTVLDIRSPN TFDNKYYVDL LNRQGLFTSD QDLYTDKRTK GIVSDFAVNQ    300
NLFFEKFVFA MLKMGQLNVL TGKQGEIRAN CSVRNANNKS LLTSVVEDVV ETLIEM*       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase8.0e-1256319280+
cd00314plant_peroxidase_like5.0e-2754316292+
pfam00141peroxidase8.0e-6056211156+
PLN03030PLN030301.0e-7238335309+
cd00693secretory_peroxidase5.0e-16439333301+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK52084.1013561354peroxidase [Nicotiana tabacum]
GenBankAAZ91676.1012941291peroxidase [Phaseolus lunatus]
DDBJBAA01950.1013561357peroxidase [Vigna angularis]
EMBLCAP72490.102335630364catharanthus roseus peroxidase 2b [Catharanthus roseus]
RefSeqXP_002302162.1083563353predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0323351305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB3hdl_A0403362304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qgj_B0403352299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0403352299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qo4_A0403313300A Chain A, Arabidopsis Thaliana Peroxidase N
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783322333253570
CU531725303423440
EV2805352551033570
CK269332306243290
CK266019306243290
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_114_00002.1Aquca_023_00176.2Aquca_023_00176.1Aquca_023_00171.1Aquca_023_00181.1
Aquca_023_00178.1Aquca_023_00180.1Aquca_023_00179.1
Arabidopsis lyrata895007
Arabidopsis thalianaAT1G71695.1
Brachypodium distachyonBradi3g13590.1Bradi3g33940.1Bradi2g09600.1Bradi4g27680.1Bradi5g27130.1
Bradi5g27150.1Bradi2g17120.1Bradi5g27220.1Bradi5g27210.1Bradi5g27200.1
Bradi5g27170.1Bradi5g27160.1
Brassica rapaBra003918Bra016127
Carica papayaevm.model.supercontig_49.84
Capsella rubellaCarubv10020541m
Citrus clementinaCiclev10001726m
Citrus sinensisorange1.1g019278m
Eucalyptus grandisEucgr.I00020.1Eucgr.F04198.1Eucgr.F04195.1Eucgr.L02740.1Eucgr.J02563.1
Fragaria vescamrna27591.1-v1.0-hybrid
Glycine maxGlyma16g27890.1Glyma10g36680.1Glyma16g27880.1Glyma16g27900.1Glyma10g36690.1
Glyma16g27900.3
Gossypium raimondiiGorai.010G131800.1Gorai.005G077600.1
Linum usitatissimumLus10028735Lus10028689
Malus domesticaMDP0000176436.181.349MDP0000176436.181.349MDP0000642832
Manihot esculentacassava4.1_025536mcassava4.1_010796mcassava4.1_025889mcassava4.1_032882mcassava4.1_031254m
cassava4.1_010776mcassava4.1_027775mcassava4.1_013268mcassava4.1_021820m
Medicago truncatulaMedtr1g106870.1
Mimulus guttatusmgv1a009174m
Oryza sativaLOC_Os08g02110.1LOC_Os01g73220.1LOC_Os01g73170.1LOC_Os01g73200.1LOC_Os04g59150.1
LOC_Os01g73190.1LOC_Os04g59160.1LOC_Os04g59200.1LOC_Os04g59210.1LOC_Os04g59260.1
LOC_Os04g59190.1LOC_Os04g59150.2
Panicum virgatumPavirv00006034mPavirv00009935mPavirv00047812mPavirv00054325mPavirv00068704m
Pavirv00024512mPavirv00006543mPavirv00052301mPavirv00016398mPavirv00020256m
Pavirv00002644m
Phaseolus vulgarisPhvul.007G082600.1Phvul.007G082700.1Phvul.004G090800.1
Picea abiesMA_62726g0010MA_10427332g0010MA_10432033g0020MA_10275776g0010MA_66200g0010
MA_497337g0010MA_57932g0010MA_13490g0020MA_8813326g0010MA_10430613g0010.304.542
MA_10430613g0010.304.542MA_10432865g0020MA_10115394g0010MA_73034g0010MA_1125g0010.202.340
MA_1125g0010.202.340MA_170633g0010MA_466251g0010
Populus trichocarpaPotri.005G195600.1Potri.002G065300.1Potri.005G195700.1
Prunus persicappa007748m
Ricinus communis28644.m00090129863.m00107629863.m001072
Setaria italicaSi001960mSi002014mSi022514mSi002007mSi022669m
Si022524mSi022622m
Selaginella moellendorffii177321230656
Sorghum bicolorSb06g033840.1Sb03g046810.1Sb03g046760.1Sb06g033870.1Sb06g033850.1
Sb06g033860.1
Thellungiella halophilaThhalv10018753mThhalv10018936m
Vitis viniferaGSVIVT01034574001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)