y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g31270.1
FamilyAA1
Protein PropertiesLength: 567 Molecular Weight: 63205.7 Isoelectric Point: 6.8915
ChromosomeChromosome/Scaffold: 20 Start: 39896986 End: 39901287
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1255530
  QAQNYTFVVREAKYTRLCSTKSILTVNGEFPGPTIRANRGDTIFIDVYNKGNFNITLHWHGVKQPRNPWTDGPSYITQCPIQPGRKFTQRLIFTFEEGTI
  WWHAHSEWLRATVYGAIHIYPNKNNPYPFPQPDAEIPIIFGEWWTSDVNEVFRQSMETGGAPNVSDALTINGQPGDLFPCSSPETFKLNVEQGKTYHLRV
  INAALNLILFFSVSQHNLTVVGADAVYTRPLTREYICISPGQAMDVLLHANQDPGHYYLAAAAYSSGVGVAFDNTTTTARVEYSGNYTPPSSPSLPNLPN
  FNDTRAALNFITNLRGLPERAPSHVPTNITTQIVTTISVNTLPCPNGRNDCQGLNGTIFSASMNNISFRIPTIDILKAYYYHINGVYEPGFPTFPPFIFN
  FTGDFLPITLNTPKQGTRVNVLNYGATVEIVFQGTNLVGGIDHPIHLHGYSFHVVGYGLGNFNQSVDPMNFNLVDPPYLNTVIVPINGWAAIRFEAVNPG
  VWFMHCHLERHQSWGMETVFIVKDGESEN
Full Sequence
Protein Sequence     Length: 567     Download
MKMARGKNLF LQILWCFSLI GLSSQAQNYT FVVREAKYTR LCSTKSILTV NGEFPGPTIR    60
ANRGDTIFID VYNKGNFNIT LHWHGVKQPR NPWTDGPSYI TQCPIQPGRK FTQRLIFTFE    120
EGTIWWHAHS EWLRATVYGA IHIYPNKNNP YPFPQPDAEI PIIFGEWWTS DVNEVFRQSM    180
ETGGAPNVSD ALTINGQPGD LFPCSSPETF KLNVEQGKTY HLRVINAALN LILFFSVSQH    240
NLTVVGADAV YTRPLTREYI CISPGQAMDV LLHANQDPGH YYLAAAAYSS GVGVAFDNTT    300
TTARVEYSGN YTPPSSPSLP NLPNFNDTRA ALNFITNLRG LPERAPSHVP TNITTQIVTT    360
ISVNTLPCPN GRNDCQGLNG TIFSASMNNI SFRIPTIDIL KAYYYHINGV YEPGFPTFPP    420
FIFNFTGDFL PITLNTPKQG TRVNVLNYGA TVEIVFQGTN LVGGIDHPIH LHGYSFHVVG    480
YGLGNFNQSV DPMNFNLVDP PYLNTVIVPI NGWAAIRFEA VNPGVWFMHC HLERHQSWGM    540
ETVFIVKDGE SENLRLPPPP PDMPPC*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_32.0e-4332145116+
PLN02191PLN021911.0e-6223545568+
PLN02604PLN026047.0e-659544580+
TIGR03388ascorbase2.0e-7742544541+
TIGR03389laccase026566542+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17753.1015661566unknown [Glycine max]
EMBLCAN60212.102156611559hypothetical protein [Vitis vinifera]
RefSeqXP_002264394.1075666567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002264702.1075662565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268422.1075662565PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0245571532A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1asq_A0245571532A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1asp_B0245571532A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1asp_A0245571532A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1aso_B0245571532A Chain A, Arabidopsis Thaliana Peroxidase N
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2669132732104820
HO797675500715670
BM52830617611760
CB97447627772810
CV53150823712350
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)