y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g32720.1
FamilyCBM57
Protein PropertiesLength: 627 Molecular Weight: 68894.1 Isoelectric Point: 5.981
ChromosomeChromosome/Scaffold: 20 Start: 41349894 End: 41355859
DescriptionDi-glucose binding protein with Leucine-rich repeat domain
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572103604.6e-25
  AGFTNHTDRFSRSWQPDYDFRTIPEDRDEVRSLSTDNSISGADEAPNYFPMKLYQSAVTTEGPLGYELSVDAKLDYTVWLHFAEIDSSVNKAGERVFDIF
  INDDNVTRLDIYNHVGAFAALTLNFTVKNLSDNVLTLKLVPAVGAPLICAI
Full Sequence
Protein Sequence     Length: 627     Download
MTRAYSFLVS LVFITMTPST PQVEAFSYHI NCGASTDSTD SFNTTWLSDR FFSAGSSALV    60
SEPLHFPLPS EKTLRFFPPS SSGKRNCYTF PSLPSPSRYL LRTFTVYDNY DAKSRPPSFD    120
VSLSSTVLFS WRSPWPESTA RNGAYSDLFA SLPNTSSLDL CFYGFATDSP LVSSIELVQV    180
HPAAYTNSNN LILVNYGRIS CGAAAKPWGA GFTNHTDRFS RSWQPDYDFR TIPEDRDEVR    240
SLSTDNSISG ADEAPNYFPM KLYQSAVTTE GPLGYELSVD AKLDYTVWLH FAEIDSSVNK    300
AGERVFDIFI NDDNVTRLDI YNHVGAFAAL TLNFTVKNLS DNVLTLKLVP AVGAPLICAI    360
ENYALVPVDP STLPLQVSAM KALKESLRVP DRMGWNGDPC APTNWDAWEG VTCRMTNDKT    420
AHVISQIDLG SQGLKGFISD QISLLSDLVS LNLSSNSLGG EIPPGLGQKS LIQVDLSNNQ    480
LMGFIPDSLA SSNLKLVLLN GNLLEGRVPE QLYSVGVHGG AIDLSGNKGL CGVPSLPSCP    540
MFWEHGRLST RGKIAIALSC LFVFCVVLLV AYIYIRRKRN DYDFALPHEL MSLAAKRNRY    600
QRQKSLMLLE LESQHAKGLP SPFTPQ*                                        660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.003279577+
pfam11721Malectin2.0e-17210360168+
pfam12819Malectin_like2.0e-5730363357+
PLN03150PLN031505.0e-977580590+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145734.102762631634hypothetical protein LOC100279241 [Zea mays]
RefSeqNP_564237.202762129622leucine-rich repeat protein-related [Arabidopsis thaliana]
RefSeqXP_002281668.102762130621PREDICTED: similar to leucine-rich repeat protein-related [Vitis vinifera]
RefSeqXP_002457393.102762629632hypothetical protein SORBIDRAFT_03g006620 [Sorghum bicolor]
RefSeqXP_002524408.102659722591serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hq1_A0.00000437748029122A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3rgz_A0.0005427539637748A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3rgz_A0.001423509224311A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3rgz_A0.008448515396465A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Transmembrane Domains
StartEnd
554576
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BX839191310273310
ES9034122741434110
GO9209872751744420
CO9812052292174420
EL3519622553035570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma15g08350.4Glyma15g08350.3
Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)