y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g36330.1
FamilyGT41
Protein PropertiesLength: 989 Molecular Weight: 111870 Isoelectric Point: 6.8691
ChromosomeChromosome/Scaffold: 20 Start: 44460757 End: 44470130
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT414687560
  RPTMAEAHANLASAYKDSGHVEAAVKSYKQALILRPDFPEATCNLLHTYQCVCCWEDRDKMFKEVEAIIRRQINMSVIPSVQPFHAIAYPLDPMLALEIS
  RKYAAHCSVIASRFSLPPFNHPAPIPIKREGGYERLRVGYVSSDFGNHPLSHLMGSVFGMHNRKNVEVFCYALSVNDGTEWRQRIQSEAEHFVDVSAMSS
  DAIAKMINEDKIHILVNLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGATYIDYLVTDEFVSPLRYANIYSEKIVHLPHCYFVNDYKQ
GT417679690
  PHKRSDYGLPEDKFIFACFNQLYKMDPEIFNTWCNILKRVPNSALWLLRFPAAGEMRLRAYAAAQGVQPDQIIFTDVAMKNEHIRRSSLADLFLDSPLCN
  AHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMEEYEDRAVSLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLH
  CSG
Full Sequence
Protein Sequence     Length: 989     Download
MISVQGDLHR HHHHYHHQPQ LPGSADTSRQ QFTADRVEPF SVKQEPASLT LLPLRGHDSS    60
EVDEDVHLSL AHQMYKTGNY KQALEHSNTV YERNPLRTDN LLLLGAVYYQ LHDFDMCVAK    120
NEEALRIEPH FAECYGNMAN AWKEKGNIDL AIRYYLIAIE LRPNFADAWS NLASAYMRKG    180
RLTEAAQCCR QALAINPLMV DAHSNLGNLM KAQGLVQEAY SCYLEALRIQ PTFAIAWSNL    240
AGLFMESGDF NRALQYYKEA VKLKPSFPDA YLNLGNVYKA LGMPQEAIAC YQHALQTRPN    300
YGMAYGNLAS IYYEQGQLDM AILHYKQAVA CDPRFLEAYN NLGNALKDVG RVEEAIQCYN    360
QCLTLQPNHP QALTNLGNIY MEWNMVAAAA QYYKATLNVT TGLSAPYNNL AIIYKQQGNY    420
VDAISCYNEV LRIDPLAADG LVNRGNTYKE IGRVSDAIQD YIRAIAVRPT MAEAHANLAS    480
AYKDSGHVEA AVKSYKQALI LRPDFPEATC NLLHTYQCVC CWEDRDKMFK EVEAIIRRQI    540
NMSVIPSVQP FHAIAYPLDP MLALEISRKY AAHCSVIASR FSLPPFNHPA PIPIKREGGY    600
ERLRVGYVSS DFGNHPLSHL MGSVFGMHNR KNVEVFCYAL SVNDGTEWRQ RIQSEAEHFV    660
DVSAMSSDAI AKMINEDKIH ILVNLNGYTK GARNEIFAMQ PAPIQVSYMG FPGTTGATYI    720
DYLVTDEFVS PLRYANIYSE KIVHLPHCYF VNDYKQKNQD VLDPNCPHKR SDYGLPEDKF    780
IFACFNQLYK MDPEIFNTWC NILKRVPNSA LWLLRFPAAG EMRLRAYAAA QGVQPDQIIF    840
TDVAMKNEHI RRSSLADLFL DSPLCNAHTT GTDILWAGLP MVTLPLEKMA TRVAGSLCLA    900
TGLGEEMIVS SMEEYEDRAV SLALNRPKLQ ALTNKLKAVR MTCPLFDTAR WVRNLERSYF    960
KMWNLHCSGQ RPQHFKVTEN DLECPYDR*                                      1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3914Spy8.0e-103408964570+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187074.10239887977SEC (secret agent); transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002270163.1019882986PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319130.10639851923predicted protein [Populus trichocarpa]
RefSeqXP_002325368.101169881873predicted protein [Populus trichocarpa]
RefSeqXP_002522031.102398815979o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03677546390C Chain C, Native Ansmecpe With Bound Adomet And Kp18cys Peptide
PDB4gz6_D0770975514718C Chain C, Native Ansmecpe With Bound Adomet And Kp18cys Peptide
PDB4gz6_D7e-311292756152C Chain C, Native Ansmecpe With Bound Adomet And Kp18cys Peptide
PDB4gz6_D7e-281973496158C Chain C, Native Ansmecpe With Bound Adomet And Kp18cys Peptide
PDB4gz6_D9e-271633096152C Chain C, Native Ansmecpe With Bound Adomet And Kp18cys Peptide
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7952474635279890
HO7787254505409890
HO79823247214710
HO7982323811375170
HO795247544775302e-21
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)