y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g37760.1
FamilyGH2
Protein PropertiesLength: 975 Molecular Weight: 110527 Isoelectric Point: 6.6108
ChromosomeChromosome/Scaffold: 20 Start: 45537486 End: 45543731
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2317580
  PSASTQPWMEAIVPGTVLATLVKNKAVPDPFRGLGNEAILDIADSGRDYYTFWFFTTFQCKLSGNQHCDLNFRGINYRADVYLNGHQMVLPKGMFRRHSL
  DVTNIIHSDGSNLLAVLVHPPDHPGSIPPQGGQGGDHEIGKDVATQYVQGWDWMAPIRDRNTGIWDEVSISITGPVKIIDPHLVSSFFDNYKRVYLHAST
  ELENRSSSTAECSLSIHATTELEGSIHLVEQLQTQNLSIPARSRVQYTFPELFFYKPNLWWPNGMGKQSLYNVIINIDIKGYGESDSWNHHFGFRKIESH
  IDGATGGRLFKVNGEPIFIRGGNWILSDGLLRLSKKRYETDIKFHADMNFNMIRCWGGGLTERPEFYHYCDYYGLLVWQEFWITGDVDGRGIPVSNPNGP
  LDHDLFLFCARDTVKLLRNHPSLALWVGGNEQTPPDDINVALKNDLKLHPYFEHGEEKEKPVGDLSPRLGDPSQYLDGTRIYIQGSLWDGFADGKGDFTD
  GPYEIQNPEDFFTDSFYNYGFNPEVGSVGMPVAATIRATMPSEGWQIPLFNKLSHGYVEEVPNPIWKYHKYIPYSNPTKKVHDQIQLYGDVKDLDDFCLK
  AQLVNYIQYRALLEGWTSHMWKKYTGVLIWKTQNPWTGLRGQFYDHLLDQTAGFYGCRCAAEPIHVQLNLATYFIEVVNTTSEELSSVAMEVSVWDLEGT
  RPHYKVHENLTALPKKVTPIVEMKYSKS
Full Sequence
Protein Sequence     Length: 975     Download
MAKTTLDSGW LAARSTEVHF TGTQLTTTHP PSASTQPWME AIVPGTVLAT LVKNKAVPDP    60
FRGLGNEAIL DIADSGRDYY TFWFFTTFQC KLSGNQHCDL NFRGINYRAD VYLNGHQMVL    120
PKGMFRRHSL DVTNIIHSDG SNLLAVLVHP PDHPGSIPPQ GGQGGDHEIG KDVATQYVQG    180
WDWMAPIRDR NTGIWDEVSI SITGPVKIID PHLVSSFFDN YKRVYLHAST ELENRSSSTA    240
ECSLSIHATT ELEGSIHLVE QLQTQNLSIP ARSRVQYTFP ELFFYKPNLW WPNGMGKQSL    300
YNVIINIDIK GYGESDSWNH HFGFRKIESH IDGATGGRLF KVNGEPIFIR GGNWILSDGL    360
LRLSKKRYET DIKFHADMNF NMIRCWGGGL TERPEFYHYC DYYGLLVWQE FWITGDVDGR    420
GIPVSNPNGP LDHDLFLFCA RDTVKLLRNH PSLALWVGGN EQTPPDDINV ALKNDLKLHP    480
YFEHGEEKEK PVGDLSPRLG DPSQYLDGTR IYIQGSLWDG FADGKGDFTD GPYEIQNPED    540
FFTDSFYNYG FNPEVGSVGM PVAATIRATM PSEGWQIPLF NKLSHGYVEE VPNPIWKYHK    600
YIPYSNPTKK VHDQIQLYGD VKDLDDFCLK AQLVNYIQYR ALLEGWTSHM WKKYTGVLIW    660
KTQNPWTGLR GQFYDHLLDQ TAGFYGCRCA AEPIHVQLNL ATYFIEVVNT TSEELSSVAM    720
EVSVWDLEGT RPHYKVHENL TALPKKVTPI VEMKYSKSKN PRPVYFLLLK LYNMSDNTIL    780
SRNFYWLHLA GGDYMLLEPY RKKKVPLKIT SEVFIEGSTY ILRMHVQNTS KKPDSKSLTL    840
VHGSTARLSN NCFVTDSPET IDSGTGKEHE VGWFKRIHKC FAGKSDGLKV SEINGQDIGV    900
AFFLHFSVHA SNKDHKEGED TRILPVHYSD NYFSVVPGET MTIKISFEVP PGVSPRVTLH    960
GWNYQGQTIH EALY*                                                     1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02836Glyco_hydro_2_C0.0002339461133+
PRK09525lacZ8.0e-6323461161+
pfam00703Glyco_hydro_21.0e-9206325120+
PRK10340ebgA2.0e-1095461382+
COG3250LacZ2.0e-3643461425+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82620.1019634965hypothetical protein [Vitis vinifera]
EMBLCBI36793.1019634943unnamed protein product [Vitis vinifera]
RefSeqXP_002284576.1019634965PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.1019654967predicted protein [Populus trichocarpa]
RefSeqXP_002512381.1019664968beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B03178774767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A03178774767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2x09_B03178774767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7939203823697460
GO8716003342976300
ES8327903064958000
FG8824262623546150
GO8476393535148660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny