y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma20g38490.1
FamilyPL1
Protein PropertiesLength: 335 Molecular Weight: 37762.9 Isoelectric Point: 7.089
ChromosomeChromosome/Scaffold: 20 Start: 46064843 End: 46067524
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1642430
  IVFEVSGTIHLSSYLSVSSYKTIDGRGQRVKLTGKGLRLKECEHIIICNLEFEGGRGHDVDGIQIKPNSRHIWIDRCTLRDYDDGLIDITRQSTDITVSR
  CCFGQHDKTMLIGADPTHIGDRCIRVTIHHCFFDGTRQRQPRVRFGKVHLYNNYTRNWGIYAVCASVESQIYSQCNVYEA
Full Sequence
Protein Sequence     Length: 335     Download
MAGMQKLPYG DVDSSLRALA GRAEGFGRLA IGGLHGPLYF VTTLSDDGPG SLREGCRRKE    60
PLWIVFEVSG TIHLSSYLSV SSYKTIDGRG QRVKLTGKGL RLKECEHIII CNLEFEGGRG    120
HDVDGIQIKP NSRHIWIDRC TLRDYDDGLI DITRQSTDIT VSRCCFGQHD KTMLIGADPT    180
HIGDRCIRVT IHHCFFDGTR QRQPRVRFGK VHLYNNYTRN WGIYAVCASV ESQIYSQCNV    240
YEAGTKKKTF EFYTEKAVDK EEQKSGFIIS EGDMFLNGAE PSLLTENREE SMFHPSEYYP    300
TWTMEAAGHS LREVLLLCTG WQSICRPVDN MVLQ*                               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C3.0e-3959241203+
COG3866PelB2.0e-4532300295+
smart00656Amb_all1.0e-6778244179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB75748.1043321339pectate lyase-like protein [Arabidopsis thaliana]
EMBLCBI32661.1043331328unnamed protein product [Vitis vinifera]
RefSeqNP_191074.2043321329pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002311134.1043281325predicted protein [Populus trichocarpa]
RefSeqXP_002526780.1043151312Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B4.99997e-411330715335A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A4.99997e-411330715335A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A4e-293129922308A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A1e-2680241130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A3e-208524282247A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY27528233043320
JG177860307243300
DY27727530073060
CX546286292123030
DY277275273063326
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)