y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G018200.1
FamilyCE8
Protein PropertiesLength: 535 Molecular Weight: 58496.2 Isoelectric Point: 7.9436
ChromosomeChromosome/Scaffold: 01 Start: 1694582 End: 1696986
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82305170
  AVVAKDGSGNYKTISEAINAASGGRFVIYVKTGVYKEKIRTNKDGITMVGDGKYSTIIVGSDSVNGGSSMPGSATFTVTGDGFMARDIGFQNTAGPQGEQ
  ALALYVASDHSVFYRCSIAGYQDTLYALSLRQFYRECDIYGTVDFIFGNAAAVFQSCTLALRRPSGYNVILASGRSDPGQNTGFSVQNCRIVPSSDFSPV
  KHSFESYLGRPWKQYSRAVVMESTIDNAIASRGWVEWPGEGGYSKSLYFAEYANVGPGAGTAGRVTWPGFHVIGRDEAAKFTVDRFIA
Full Sequence
Protein Sequence     Length: 535     Download
MINFSDTTML EFITMFRVMG LVLMVTQGCL AANQKHVDEQ CRFTRYSTLC VDTMTGLGSE    60
NQKPDILSAL INKTILETQL PTSYFTKFTT ALHVDEAQHV NSITGYCEEL LSMSLKRLDQ    120
SLLALKNSPN KNKHDIQTWI SAALTYQQAC KDSADSHNFS NGDLMGQISQ KMDYLSQLGS    180
NTLALANRIP GELTHFTKSR RLAEADRVFP EWLSAKDRKL LQVLTVKANA VVAKDGSGNY    240
KTISEAINAA SGGRFVIYVK TGVYKEKIRT NKDGITMVGD GKYSTIIVGS DSVNGGSSMP    300
GSATFTVTGD GFMARDIGFQ NTAGPQGEQA LALYVASDHS VFYRCSIAGY QDTLYALSLR    360
QFYRECDIYG TVDFIFGNAA AVFQSCTLAL RRPSGYNVIL ASGRSDPGQN TGFSVQNCRI    420
VPSSDFSPVK HSFESYLGRP WKQYSRAVVM ESTIDNAIAS RGWVEWPGEG GYSKSLYFAE    480
YANVGPGAGT AGRVTWPGFH VIGRDEAAKF TVDRFIAGNF WLPSTGVTFI SGLQ*         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02170PLN021702.0e-14376533474+
PLN02484PLN024843.0e-14437533526+
PLN02301PLN023013.0e-152107533440+
pfam01095Pectinesterase7.0e-160229519299+
PLN02698PLN02698032534507+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK24761.103553350555unknown [Picea sitchensis]
GenBankABK24883.104153369568unknown [Picea sitchensis]
RefSeqNP_197586.103251230489pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002277293.10325344480PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002516196.1095341527Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02265331315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A02255334319A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_B8e-282294885311A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_A8e-282294885311A Chain A, Pectin Methylesterase From Carrot
PDB2ntp_B8e-282294885311A Chain A, Pectin Methylesterase From Carrot
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX6360302672385030
EE2553242462925350
DV1341332611804370
CD5745562592765330
EY6632392651954580
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00025.1Aquca_020_00595.1
Arabidopsis lyrata326467
Arabidopsis thalianaAT5G20860.1
Brassica rapaBra020131
Carica papayaevm.model.supercontig_344.3
Capsella rubellaCarubv10003708m
Citrus clementinaCiclev10007964m
Citrus sinensisorange1.1g011489morange1.1g009545morange1.1g011611morange1.1g009418morange1.1g009682m
Eucalyptus grandisEucgr.C00760.1
Fragaria vescamrna12962.1-v1.0-hybrid
Glycine maxGlyma09g08900.2
Linum usitatissimumLus10017665Lus10033621Lus10025510
Malus domesticaMDP0000545023.761.939MDP0000545023.761.939
Manihot esculentacassava4.1_005313mcassava4.1_005427m
Mimulus guttatusmgv1a024664mmgv1a004362m
Phaseolus vulgarisPhvul.009G222700.1
Picea abiesMA_10435891g0010
Populus trichocarpaPotri.006G135100.1Potri.006G135100.2
Prunus persicappa016574m
Ricinus communis29739.m003679
Thellungiella halophilaThhalv10013149m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny