y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G039100.1
FamilyGT28
Protein PropertiesLength: 532 Molecular Weight: 58527.6 Isoelectric Point: 9.3311
ChromosomeChromosome/Scaffold: 01 Start: 3646648 End: 3650464
Descriptionmonogalactosyl diacylglycerol synthase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT283485062.3e-28
  VLLMGGGEGMGPIEATARALEHALYDENLGEPLGQILVICGHNKRLASKLLSIDWKIPVQVKGFVTKMEECMGSCDCIITKAGPGTIAEAMIRGLPIVLN
  DFIAGQEVGNVPFVVENGCGKFSKSPKEIANIISQWFGPKADELKSMSENALRLARPEA
Full Sequence
Protein Sequence     Length: 532     Download
MQNPSTVTQE SGPAAFDLVT QLGHLAFNKS FRSSNTDGFC SFKPNHVYFS GFRDSISQKK    60
RRVAAAASLS LGARNSVSSS VRRILNDFNR AIKFHCDRIP IGFASIRVGS EDNNGVRDGG    120
GGVLEVEGLP LNGVETETPK KVLILMSDTG GGHRASAEAI KAAFNEEFGD EYQVFVTDLW    180
SDHTPWPFNQ LPKSYNFLVK HGSLWRLTYY GTAPRVIYQS NFAATSTFIA REVAKGLMKY    240
QPDIIISVHP LMQHVPLRIL KSKGLLKKIV FTTVVTDLST CHPTWFHKLV TRCYCPSAEV    300
AKRALKAGLQ PSQIKVYGLP IRPSFVKPVR PKIELRRELG MDEDLPAVLL MGGGEGMGPI    360
EATARALEHA LYDENLGEPL GQILVICGHN KRLASKLLSI DWKIPVQVKG FVTKMEECMG    420
SCDCIITKAG PGTIAEAMIR GLPIVLNDFI AGQEVGNVPF VVENGCGKFS KSPKEIANII    480
SQWFGPKADE LKSMSENALR LARPEAVFKI VHDLHQLVRQ RNFVPQFSCT T*            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG6.0e-26141511379+
PRK13608PRK136084.0e-29140518389+
PRK13609PRK136092.0e-44138517389+
pfam06925MGDG_synth2.0e-75153321169+
PLN02605PLN026050142521382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN84152.1075311520hypothetical protein [Vitis vinifera]
RefSeqNP_194906.1015301532MGD1 (MONOGALACTOSYL DIACYLGLYCEROL SYNTHASE 1); 1,2-diacylglycerol 3-beta-galactosyltransferase/ UDP-galactosyltransferase/ UDP-glycosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002283410.10553131552PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309689.1015311537predicted protein [Populus trichocarpa]
RefSeqXP_002515397.10152915331,2-diacylglycerol 3-beta-galactosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A0.00005404519235356A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2679733421695100
EX2601723001654640
GT0492283361855200
CV5305402951374310
HO4664773821395200
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)