y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G043100.2
FamilyGH17
Protein PropertiesLength: 282 Molecular Weight: 30490.8 Isoelectric Point: 7.0905
ChromosomeChromosome/Scaffold: 01 Start: 4089003 End: 4092393
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17301384e-35
  GINYGRIANNILSPDDVVTLLRAAKIKNVRIYDFDQSVLKAFSGTGLELVVGLPNENLRDVSANADHAMNWVKDNVLAYLPDTHIRGIAIGNEVLGSSDE
  FSGFLLGAI
GH171372401e-35
  AIDAAYAALEDAGYGKMEVIVTETGWASHGDENEAAATTNNARTYNYNLRKRLAKMKGTPLRPKSVLKVYVFAIFNENLKPGPTSERNFGLFKPDGSISY
  DIGF
Full Sequence
Protein Sequence     Length: 282     Download
MKSFGVHLFF LLFLAAIASV TVQAFTGTYG INYGRIANNI LSPDDVVTLL RAAKIKNVRI    60
YDFDQSVLKA FSGTGLELVV GLPNENLRDV SANADHAMNW VKDNVLAYLP DTHIRGIAIG    120
NEVLGSSDEF SGFLLGAIDA AYAALEDAGY GKMEVIVTET GWASHGDENE AAATTNNART    180
YNYNLRKRLA KMKGTPLRPK SVLKVYVFAI FNENLKPGPT SERNFGLFKP DGSISYDIGF    240
HGFKSSSADS SLLSLKEIRA SSWSGSYSII LTMATALLLV L*                       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_171.0e-1515324088+
pfam00332Glyco_hydro_178.0e-2930129100+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABI49503.1018260447743Glycosyl hydrolases family 17 protein [Solanum demissum]
EMBLCBI28222.10628111339unnamed protein product [Vitis vinifera]
RefSeqXP_002282272.10614611150PREDICTED: similar to beta-1,3-glucanase 1 [Vitis vinifera]
RefSeqXP_002282272.10129281240391PREDICTED: similar to beta-1,3-glucanase 1 [Vitis vinifera]
RefSeqXP_002308978.10129248217336predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghs_B9e-21138240210306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_B4e-16301292101A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A9e-21138240210306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A4e-16301292101A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB2cyg_A1e-20302372202A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO118527103311330
CO12084313311330
CO114700119151330
BM528126108211280
CO114700161521670.63
Orthologous Group
SpeciesID
Brassica rapaBra017659.289.392Bra017659.289.392
Gossypium raimondiiGorai.001G043100.2.137.240Gorai.001G043100.2.137.240
Linum usitatissimumLus10032039
Malus domesticaMDP0000179206.203.304MDP0000179206.203.304
Oryza sativaLOC_Os11g47820.2.212.313LOC_Os11g47820.2.212.313
Picea abiesMA_6517678g0010MA_10435812g0020
Populus trichocarpaPotri.014G182600.1
Vitis viniferaGSVIVT01015563001.185.299GSVIVT01015563001.185.299GSVIVT01016553001.199.300GSVIVT01016553001.199.300
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny