y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G062400.1
FamilyPL1
Protein PropertiesLength: 402 Molecular Weight: 44347 Isoelectric Point: 8.1384
ChromosomeChromosome/Scaffold: 01 Start: 6257997 End: 6260011
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11153210
  IQDEPLWIVFARDMTIQLKEELIMNSFKTIDGRGASVHITGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRDSPRHYGWRTTSDGDGVSIFGGSHIWVD
  HNSLSNCKDGLIDAIYGSTAITISNNHMTHHDKVMLLGHSDSYMKDKNMQVTIAFNHFGKGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ
  GNRFTAP
Full Sequence
Protein Sequence     Length: 402     Download
MAIPSLSLLF LFTSLPLFSS SPVKDPELVV QDLHRAINVS RRNLKYLSCA TGNPIDDCWR    60
CDPNWEKNRR RLADCAIGFG KNAIGGRDGK LYVVTDSSDD DPVNPKPGTL RHAVIQDEPL    120
WIVFARDMTI QLKEELIMNS FKTIDGRGAS VHITGGPCIT IQFVTNIIIH GLHIHDCKQG    180
GNAMVRDSPR HYGWRTTSDG DGVSIFGGSH IWVDHNSLSN CKDGLIDAIY GSTAITISNN    240
HMTHHDKVML LGHSDSYMKD KNMQVTIAFN HFGKGLIQRM PRCRHGYFHV VNNDYTHWEM    300
YAIGGSANPT INSQGNRFTA PNDIFSKEVT KHEDAPESEW KNWNWRSEGD LMVNGAFFTR    360
SGAGASSSYA KASSLGARPS SHVATITTNA GALNCKKGSR C*                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB7.0e-26140318191+
pfam00544Pec_lyase_C1.0e-69133318209+
smart00656Amb_all1.0e-79127322207+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankADB90475.102440134411pectate lyase [Gossypium herbaceum]
GenBankADB90476.102440134411pectate lyase [Gossypium raimondii]
GenBankADB90477.102440134411pectate lyase [Gossypium hirsutum]
GenBankADB90478.102440134411pectate lyase [Gossypium hirsutum]
GenBankADB90479.102440134411pectate lyase [Gossypium barbadense]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0533932345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0533932345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A8e-1812231850246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A2e-16125324114336A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pe9_B0.0000000000008166392115358A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG606120337233590
HO778688382234020
DY272271322233440
DY278910336233580
CO072740286273120
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00377.2Aquca_011_00377.1Aquca_056_00058.1Aquca_034_00209.3Aquca_034_00209.1
Aquca_108_00001.2Aquca_108_00001.1Aquca_034_00209.2Aquca_038_00141.1Aquca_030_00036.1
Aquca_011_00023.1Aquca_070_00020.1Aquca_011_00011.1Aquca_066_00046.1Aquca_074_00067.1
Aquca_002_00501.1Aquca_038_00142.2Aquca_038_00142.1
Arabidopsis lyrata496502475879478021495658355442
887643492364898940487211494953
333008899063485694865133312221
492665485907471616488352477401
484177
Arabidopsis thalianaAT5G63180.1AT1G67750.1AT3G07010.1AT5G55720.1AT1G04680.1
AT4G13710.2AT4G13710.1AT3G24670.1AT4G24780.2AT4G24780.1
AT3G24230.1AT5G04310.1AT5G48900.1AT4G13210.2AT4G13210.1
AT3G53190.1AT3G27400.1AT4G22090.1AT3G54920.1AT4G22080.1
AT1G11920.1AT1G14420.1AT3G01270.1AT5G15110.1AT2G02720.1
Brachypodium distachyonBradi5g01135.1Bradi3g27926.1Bradi1g37280.1Bradi3g08035.1
Brassica rapaBra019209Bra035852Bra038614Bra004073Bra010482
Bra013833Bra036155Bra035588Bra004254Bra015000
Bra030583Bra032494Bra015341Bra032730Bra040809
Bra032696Bra033980Bra020672Bra009469Bra015070
Bra005799Bra003200Bra007116Bra028549Bra039081
Bra006976Bra029614Bra025274Bra013585Bra020859
Bra026832Bra001011Bra026221Bra019729Bra016700
Bra019730Bra017412Bra023504Bra033008Bra006279
Bra008721Bra026583Bra024811
Carica papayaevm.model.supercontig_4.36evm.model.supercontig_59.92evm.model.supercontig_33.89evm.model.supercontig_8.183evm.model.supercontig_53.152
evm.model.supercontig_92.98evm.model.supercontig_17.208evm.model.supercontig_152.39evm.model.supercontig_14.39evm.model.supercontig_862.2
evm.model.supercontig_5.270
Capsella rubellaCarubv10026494mCarubv10020387mCarubv10013945mCarubv10013802mCarubv10027870m
Carubv10009197mCarubv10004942mCarubv10004736mCarubv10013661mCarubv10000891m
Carubv10000723mCarubv10026482mCarubv10006630mCarubv10013715mCarubv10017111m
Carubv10017351mCarubv10007804mCarubv10017065mCarubv10011187mCarubv10012514m
Carubv10018855mCarubv10002862mCarubv10016149m
Citrus clementinaCiclev10008571mCiclev10020423mCiclev10031429mCiclev10019202mCiclev10004845m
Ciclev10004783mCiclev10015474mCiclev10031337mCiclev10011635mCiclev10017878m
Ciclev10020193mCiclev10011763mCiclev10011762mCiclev10013750mCiclev10031653m
Citrus sinensisorange1.1g016398morange1.1g019664morange1.1g015569morange1.1g023995morange1.1g019799m
orange1.1g015702morange1.1g013239morange1.1g010437morange1.1g015685morange1.1g023976m
orange1.1g015623morange1.1g018853morange1.1g014647morange1.1g011204morange1.1g011814m
orange1.1g047672morange1.1g013757morange1.1g023251morange1.1g023390morange1.1g044170m
orange1.1g036607m
Cucumis sativusCucsa.391620.1Cucsa.194310.1Cucsa.256180.2Cucsa.256180.1Cucsa.140360.1
Cucsa.186200.1Cucsa.394640.2Cucsa.308710.1Cucsa.011030.1Cucsa.124770.1
Cucsa.045020.1Cucsa.005440.1Cucsa.085530.1Cucsa.285320.1Cucsa.097920.1
Cucsa.339080.1Cucsa.394640.1
Eucalyptus grandisEucgr.C02252.1Eucgr.F02050.1Eucgr.H02448.1Eucgr.B00168.1Eucgr.K03600.1
Eucgr.H02860.2Eucgr.H02860.1Eucgr.G02887.1Eucgr.G02748.1Eucgr.H00093.2
Eucgr.H00093.1Eucgr.G02748.2Eucgr.J02266.1Eucgr.D01352.1Eucgr.G02541.1
Eucgr.G02162.1Eucgr.J02132.1
Fragaria vescamrna10004.1-v1.0-hybridmrna24370.1-v1.0-hybridmrna17555.1-v1.0-hybridmrna23429.1-v1.0-hybridmrna09684.1-v1.0-hybrid
mrna27998.1-v1.0-hybridmrna16611.1-v1.0-hybridmrna19480.1-v1.0-hybridmrna25949.1-v1.0-hybridmrna01266.1-v1.0-hybrid
mrna19804.1-v1.0-hybrid
Glycine maxGlyma05g02890.1Glyma17g13550.2Glyma17g13550.1Glyma04g36520.1Glyma06g18370.1
Glyma18g01560.1Glyma19g07490.1Glyma11g37610.1Glyma20g19200.1Glyma05g23950.1
Glyma18g38430.1Glyma08g47161.1Glyma10g24630.1Glyma03g34260.1Glyma15g11700.1
Glyma13g20890.1Glyma20g24670.1Glyma10g42390.1Glyma17g01470.2Glyma09g00850.1
Glyma19g02390.1Glyma08g40820.2Glyma01g04970.1Glyma18g01570.2Glyma13g05150.1
Glyma11g37620.1Glyma02g02460.1Glyma04g34260.2Glyma18g49090.1Glyma09g00841.1
Gossypium raimondiiGorai.009G450300.1Gorai.008G162500.2Gorai.003G108300.1Gorai.008G162500.1Gorai.008G203900.2
Gorai.008G203900.1Gorai.006G219800.2Gorai.006G219800.1Gorai.011G161900.1Gorai.001G267300.1
Gorai.007G152500.1Gorai.009G339700.1Gorai.008G203900.4Gorai.005G174600.2Gorai.005G174600.1
Gorai.006G036300.1Gorai.006G219800.4Gorai.002G189900.1Gorai.001G184600.1Gorai.009G309900.1
Gorai.009G309900.2Gorai.002G246200.1Gorai.011G012500.1Gorai.010G207200.3Gorai.010G207200.1
Gorai.010G207200.4Gorai.010G182700.1Gorai.002G246200.2Gorai.009G439300.1Gorai.009G438700.1
Gorai.003G094800.1Gorai.003G108300.2Gorai.008G203900.3Gorai.006G219800.3Gorai.002G064100.1
Gorai.005G174600.3Gorai.006G024800.1Gorai.012G187800.1Gorai.005G227000.1Gorai.007G265100.1
Gorai.009G334700.1Gorai.007G078600.1Gorai.N020100.1Gorai.N020200.1Gorai.009G334500.1
Gorai.009G334800.1Gorai.N020300.1Gorai.013G077600.2Gorai.013G077600.1Gorai.013G078300.1
Gorai.013G078500.1Gorai.013G078000.1Gorai.010G207200.2Gorai.009G334600.1
Linum usitatissimumLus10036946Lus10033037Lus10006456Lus10011400Lus10011758
Lus10022817Lus10011885Lus10023679Lus10038157Lus10022310
Lus10014887Lus10014414Lus10023542Lus10013667Lus10006241
Lus10023917Lus10037945.486.691Lus10037945.486.691Lus10011258Lus10011257
Lus10018430Lus10018429Lus10005254Lus10013668Lus10036721
Lus10030791Lus10037207Lus10023623Lus10030670Lus10033018
Lus10015359Lus10037945.136.295Lus10037945.136.295Lus10013267
Malus domesticaMDP0000394944MDP0000201389MDP0000718765MDP0000573746MDP0000631698
MDP0000491898MDP0000319156MDP0000277149MDP0000266603MDP0000285495
MDP0000145734MDP0000181608MDP0000302503MDP0000150610MDP0000133529
MDP0000276859MDP0000256522MDP0000232225MDP0000236210MDP0000289069
MDP0000205892MDP0000301545MDP0000518885MDP0000482731MDP0000701129
MDP0000454269MDP0000137872
Manihot esculentacassava4.1_033025mcassava4.1_008855mcassava4.1_009041mcassava4.1_009002mcassava4.1_008852m
cassava4.1_007737mcassava4.1_007840mcassava4.1_007516mcassava4.1_007568mcassava4.1_027215m
cassava4.1_006659mcassava4.1_029354mcassava4.1_006540mcassava4.1_022396mcassava4.1_006106m
cassava4.1_028711mcassava4.1_028419mcassava4.1_013270mcassava4.1_022024mcassava4.1_023546m
cassava4.1_020968m
Medicago truncatulaMedtr4g104320.1Medtr6g021950.1Medtr3g086310.1Medtr7g059290.1Medtr3g086320.1
Medtr6g045700.1Medtr4g132460.1Medtr7g009390.1Medtr5g038490.1Medtr5g038510.1
Medtr4g107870.1
Mimulus guttatusmgv1a007737mmgv1a007460mmgv1a007569mmgv1a007094mmgv1a006554m
mgv1a023431mmgv1a004990mmgv1a006198mmgv1a006571mmgv1a005520m
mgv1a006100mmgv1a024530mmgv1a008057mmgv1a006379mmgv1a006386m
mgv1a011674mmgv1a006498mmgv1a006496m
Oryza sativaLOC_Os04g05050.2LOC_Os04g05050.1LOC_Os10g31910.1LOC_Os06g05260.1LOC_Os02g12300.1
LOC_Os06g38510.2LOC_Os06g38510.1LOC_Os06g05272.1LOC_Os06g05209.1
Panicum virgatumPavirv00014056mPavirv00052749mPavirv00054428mPavirv00024398mPavirv00044587m
Pavirv00005788mPavirv00001518mPavirv00065339mPavirv00053507mPavirv00025288m
Physcomitrella patensPp1s563_1V6.3Pp1s563_1V6.2Pp1s563_1V6.1Pp1s355_16V6.1Pp1s67_160V6.1
Pp1s112_172V6.1Pp1s84_82V6.1Pp1s173_162V6.1Pp1s28_242V6.1Pp1s409_2V6.1
Pp1s92_84V6.1Pp1s92_82V6.1Pp1s204_112V6.1Pp1s206_50V6.1
Phaseolus vulgarisPhvul.003G207400.1Phvul.004G059200.1Phvul.009G170500.1Phvul.001G256900.1Phvul.007G236800.1
Phvul.008G123000.1Phvul.007G024400.1Phvul.001G180800.1Phvul.007G151200.1Phvul.006G147600.1
Phvul.003G081000.1Phvul.001G256800.1Phvul.006G147500.1Phvul.003G069100.1Phvul.004G026400.1
Phvul.009G125800.1Phvul.009G189800.1Phvul.002G065800.1Phvul.008G043600.1
Picea abiesMA_476625g0010MA_956526g0010MA_10437227g0020MA_91467g0010MA_10428603g0020
MA_97947g0010MA_10205415g0010MA_10353668g0010MA_928735g0010MA_10430145g0030
MA_203992g0010MA_103716g0010MA_10426822g0020MA_474372g0010MA_185203g0010
MA_66914g0010MA_10430145g0020MA_10437227g0030.141.319MA_10437227g0030.141.319MA_101171g0010
MA_6474333g0010MA_10437227g0030.312.446MA_10437227g0030.312.446
Populus trichocarpaPotri.004G007300.1Potri.011G093400.2Potri.011G093400.1Potri.001G367800.1Potri.015G087800.2
Potri.015G087800.1Potri.012G091500.2Potri.012G091500.1Potri.012G091300.1Potri.014G178100.2
Potri.014G178100.1Potri.002G238800.1Potri.001G052300.1Potri.003G175900.1Potri.008G182200.2
Potri.008G182200.1Potri.010G051800.2Potri.010G051800.1Potri.001G339500.2Potri.001G339500.1
Potri.006G122000.1Potri.008G032700.2Potri.008G032700.1Potri.010G229000.3Potri.010G229000.1
Potri.T040400.1Potri.011G008000.1Potri.010G229000.2Potri.T040300.1Potri.011G008100.1
Potri.015G064700.1Potri.017G078400.1Potri.008G148800.1Potri.004G124100.1
Prunus persicappa006392mppa006665mppa006229mppa005761mppa004881m
ppa006569mppa003600mppa005744mppa025559mppa019055m
ppa005859mppa005602mppa016012m
Ricinus communis29629.m00137629929.m00477329633.m00091330204.m00179630147.m013824
29904.m00299430078.m00225829898.m00006529842.m00355229842.m003553
29736.m00203230147.m014076
Setaria italicaSi010221mSi035441mSi006451mSi017224mSi006418m
Selaginella moellendorffii40749581909439243
Sorghum bicolorSb06g001410.1Sb01g020180.1Sb10g003080.1Sb10g003090.1Sb04g007450.1
Sb10g022830.1
Thellungiella halophilaThhalv10016093m
Vitis viniferaGSVIVT01014682001GSVIVT01007582001GSVIVT01000592001GSVIVT01003984001GSVIVT01028548001
GSVIVT01029048001GSVIVT01016208001GSVIVT01012679001GSVIVT01011348001GSVIVT01020068001
GSVIVT01016209001GSVIVT01020067001GSVIVT01008053001
Zea maysAC194852.3_FGT007
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)