y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G067900.1
FamilyGT28
Protein PropertiesLength: 353 Molecular Weight: 38352.8 Isoelectric Point: 9.2333
ChromosomeChromosome/Scaffold: 01 Start: 6810550 End: 6813475
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282563521.1e-30
  ILVLGGSLGANAVNIALLNVYSQLLLEHENWFIIWQTGVESFNEMESLVRSHPRLLLAPFLHSMNMAYAAADLVVSRAGAMTCSEILATGKPSILVD
Full Sequence
Protein Sequence     Length: 353     Download
MASTTQFLIS LPPKPPYLLS YSSPSKPRSI NITCCLSIQQ ARNDQTTSSG SNALNGLRVA    60
FAAGGTGGHI YPAVAIADEL KLVNPTSEIL FLGRPNSMES TAIPSAHFEF KSIPAFKLVR    120
PFFSLRNLLL PYFLIKSITK CFTLLSKFEP HLVVGTGGYV SFPVCLAALL KGIKVVIQEQ    180
NSVPGIANRF LSLFADLVFV AFNSTVQSFP RKEKCVVCGN PVRLSLKNSV SKAVSRLHFF    240
PWLEKMEGSS EEIKVILVLG GSLGANAVNI ALLNVYSQLL LEHENWFIIW QTGVESFNEM    300
ESLVRSHPRL LLAPFLHSMN MAYAAADLVV SRAGAMTCSE ILATGKPSIL VD*           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK12446PRK124462.0e-3458351305+
TIGR01133murG3.0e-7558351296+
COG0707MurG6.0e-7758351294+
PRK00726murG3.0e-9758351294+
cd03785GT1_MurG3.0e-10658351295+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15500.1093518352unnamed protein product [Vitis vinifera]
RefSeqNP_177515.102935128349glycosyl transferase family 28 protein [Arabidopsis thaliana]
RefSeqXP_002277203.103035132347PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317900.10293511320predicted protein [Populus trichocarpa]
RefSeqXP_002524882.101335123353UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A5e-36593515278A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B3e-33553515280A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A3e-33553515280A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B3e-33553515280A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A3e-33553515280A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES821435297553510
DW243293285673510
ES821129279683460
DW243599252673180
ES80998924812480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brachypodium distachyonBradi2g13780.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Fragaria vescamrna09449.1-v1.0-hybrid
Glycine maxGlyma08g05420.2Glyma05g34250.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.3
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Oryza sativaLOC_Os01g33230.1
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny