y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G067900.3
FamilyGT28
Protein PropertiesLength: 256 Molecular Weight: 28165.2 Isoelectric Point: 8.9972
ChromosomeChromosome/Scaffold: 01 Start: 6810550 End: 6813155
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT281592555.8e-31
  ILVLGGSLGANAVNIALLNVYSQLLLEHENWFIIWQTGVESFNEMESLVRSHPRLLLAPFLHSMNMAYAAADLVVSRAGAMTCSEILATGKPSILVD
Full Sequence
Protein Sequence     Length: 256     Download
MESTAIPSAH FEFKSIPAFK LVRPFFSLRN LLLPYFLIKS ITKCFTLLSK FEPHLVVGTG    60
GYVSFPVCLA ALLKGIKVVI QEQNSVPGIA NRFLSLFADL VFVAFNSTVQ SFPRKEKCVV    120
CGNPVRLSLK NSVSKAVSRL HFFPWLEKME GSSEEIKVIL VLGGSLGANA VNIALLNVYS    180
QLLLEHENWF IIWQTGVESF NEMESLVRSH PRLLLAPFLH SMNMAYAAAD LVVSRAGAMT    240
CSEILATGKP SILVD*                                                    300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK12446PRK124462.0e-281254265+
TIGR01133murG4.0e-591254256+
COG0707MurG6.0e-631254254+
PRK00726murG2.0e-781254254+
cd03785GT1_MurG4.0e-861254255+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15500.101254102352unnamed protein product [Vitis vinifera]
RefSeqNP_177515.10125494349glycosyl transferase family 28 protein [Arabidopsis thaliana]
RefSeqXP_002277203.10125497347PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317900.10125473320predicted protein [Populus trichocarpa]
RefSeqXP_002524882.101254104353UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A1e-283425474278A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B2e-253425478280A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A2e-253425478280A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B2e-253425478280A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A2e-253425478280A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES82143525412540
DW24329325412540
ES82112924912490
DW24359922112210
CO115843208472540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brachypodium distachyonBradi2g13780.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Fragaria vescamrna09449.1-v1.0-hybrid
Glycine maxGlyma08g05420.2Glyma05g34250.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.1
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Oryza sativaLOC_Os01g33230.1
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny