y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G078400.1
FamilyGH89
Protein PropertiesLength: 839 Molecular Weight: 95842.6 Isoelectric Point: 5.9208
ChromosomeChromosome/Scaffold: 01 Start: 8106500 End: 8117642
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH89964300
  PEILISGVTGVEVLAGLHWYLKYWCGSHISWQKTGGAQLFSIPPLGSLPPVQDGGILVQRPIPWNYYQNAVTSSYTFAWWDWERWEQEIDWMALQGINLP
  LAFTGQETIWRKVFQKFNITNSDLDDFFGGPAFLAWSRMGNLHGWGGPLPESWFDGQLTLQKKILARMYELGMTPVLPAFSGNVPAAFKDMFPSAKITRL
  GNWFSVKRNPKWCCTYLLDATDPLFIEIGRTFIEEQLKGVDTFDENTPPVDDPGYISSLGAAIFSGMQSGDDNAMWLMQGWLFSYDPFWRPPQMKALLHS
  VPLGKLVVLDLYAEVKPIWISSEQFYGVPYIWKAL
GH894668320
  EVWNLCMLHNFAGNIEMYGILDAIASGPIEALTSENSTMVGIGMSMEGIEQNPIVYDLMSEMAFQHKKVDVKAWIELYIARRYGRSSPLIRDAWNILYHT
  IYNCTDGAYDKNRDVIVAFPDVNPSLISSPLEMYPHNGKPTSRRAVQREKTNAYEQPHLWYSTSEVIKALELFIASGNELSASNTYSYDLVDLTRQSLAK
  YANELFLKIIDAYKFKDVDKVTSLSQKFLDLVEDMDTLLACHDGFLLGPWLESAKQLAQNEEEEKQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGL
  LRDYYGPRAAIYFKILIESVENGEDFKLHKWRREWIKLTNNWQSSRKLFPVKSSGNAVSISRSLYNK
Full Sequence
Protein Sequence     Length: 839     Download
MDSSLAAISL LLFSLFSMVY SSPIGVQYIS KLLQIQERER ALPSFQVAAA RGVLHRLLPS    60
HSSAFEFRII SKEKCGGEGA CFIINNHPSS YKSGAPEILI SGVTGVEVLA GLHWYLKYWC    120
GSHISWQKTG GAQLFSIPPL GSLPPVQDGG ILVQRPIPWN YYQNAVTSSY TFAWWDWERW    180
EQEIDWMALQ GINLPLAFTG QETIWRKVFQ KFNITNSDLD DFFGGPAFLA WSRMGNLHGW    240
GGPLPESWFD GQLTLQKKIL ARMYELGMTP VLPAFSGNVP AAFKDMFPSA KITRLGNWFS    300
VKRNPKWCCT YLLDATDPLF IEIGRTFIEE QLKGVDTFDE NTPPVDDPGY ISSLGAAIFS    360
GMQSGDDNAM WLMQGWLFSY DPFWRPPQMK ALLHSVPLGK LVVLDLYAEV KPIWISSEQF    420
YGVPYIWKAL LERDLDLFRV FDRNFAYFIH PLKYVSVAYL KASKMEVWNL CMLHNFAGNI    480
EMYGILDAIA SGPIEALTSE NSTMVGIGMS MEGIEQNPIV YDLMSEMAFQ HKKVDVKAWI    540
ELYIARRYGR SSPLIRDAWN ILYHTIYNCT DGAYDKNRDV IVAFPDVNPS LISSPLEMYP    600
HNGKPTSRRA VQREKTNAYE QPHLWYSTSE VIKALELFIA SGNELSASNT YSYDLVDLTR    660
QSLAKYANEL FLKIIDAYKF KDVDKVTSLS QKFLDLVEDM DTLLACHDGF LLGPWLESAK    720
QLAQNEEEEK QFEWNARTQI TMWFDNTEEE ASLLRDYGNK YWSGLLRDYY GPRAAIYFKI    780
LIESVENGED FKLHKWRREW IKLTNNWQSS RKLFPVKSSG NAVSISRSLY NKYLRSES*     840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N9.0e-2046146101+
pfam12972NAGLU_C8.0e-100538833296+
pfam05089NAGLU8.0e-169161531379+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15090.102183523839unnamed protein product [Vitis vinifera]
GenBankEEC78143.102883532808hypothetical protein OsI_17702 [Oryza sativa Indica Group]
RefSeqXP_002280399.102183523806PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318632.102183426804predicted protein [Populus trichocarpa]
RefSeqXP_002511461.1018361802alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A093819209862A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2vcb_A093819209862A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2vca_A093819209862A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2vc9_A093819209862A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A093819232885A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7831284643388000
DY278644313213330
DY267221313213330
FC909669292213120
DY267221683364010.004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)